Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094GDF5

Protein Details
Accession A0A094GDF5    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-110NFVPRFLRTKRRARKARMAAPPPHydrophilic
NLS Segment(s)
PositionSequence
95-104RTKRRARKAR
Subcellular Location(s) mito 18, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029069  HotDog_dom_sf  
Amino Acid Sequences MHVAIRELHRKPSLIIGPDGKPAKGQWGIMLGGVHCSFKREIKPYEKYEMWSRMLAWDRKWLYVVTHFVKAGTARPAGWTLDDPKDWNFVPRFLRTKRRARKARMAAPPPDVPEGAIFASAISKYVMKVGRLTVHPEAVLDMCDLLPPKPGGWNTMDGRKEEVVEEAEGLEEMEMGESVLSILGIPNGKVEVLGNGSANGVANGAANGAAKEAGAVTGWDWKMVEAENARGMEYAKHHAALDSLSETFTGNKHPALGYYTDIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.4
4 0.39
5 0.45
6 0.46
7 0.37
8 0.32
9 0.29
10 0.31
11 0.29
12 0.27
13 0.22
14 0.23
15 0.24
16 0.23
17 0.24
18 0.16
19 0.17
20 0.18
21 0.17
22 0.13
23 0.16
24 0.17
25 0.21
26 0.29
27 0.32
28 0.39
29 0.47
30 0.55
31 0.58
32 0.64
33 0.6
34 0.57
35 0.58
36 0.57
37 0.5
38 0.43
39 0.38
40 0.36
41 0.42
42 0.41
43 0.34
44 0.38
45 0.36
46 0.36
47 0.37
48 0.31
49 0.26
50 0.28
51 0.33
52 0.27
53 0.28
54 0.27
55 0.26
56 0.27
57 0.25
58 0.22
59 0.2
60 0.17
61 0.15
62 0.16
63 0.18
64 0.17
65 0.17
66 0.16
67 0.17
68 0.19
69 0.2
70 0.2
71 0.19
72 0.22
73 0.21
74 0.24
75 0.21
76 0.22
77 0.26
78 0.3
79 0.36
80 0.38
81 0.49
82 0.51
83 0.61
84 0.66
85 0.73
86 0.77
87 0.78
88 0.83
89 0.82
90 0.83
91 0.82
92 0.78
93 0.71
94 0.66
95 0.6
96 0.51
97 0.43
98 0.33
99 0.24
100 0.18
101 0.15
102 0.11
103 0.09
104 0.06
105 0.05
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.09
113 0.11
114 0.11
115 0.12
116 0.13
117 0.16
118 0.16
119 0.21
120 0.17
121 0.16
122 0.16
123 0.15
124 0.14
125 0.11
126 0.1
127 0.06
128 0.05
129 0.05
130 0.05
131 0.06
132 0.05
133 0.08
134 0.07
135 0.08
136 0.11
137 0.12
138 0.13
139 0.15
140 0.2
141 0.2
142 0.27
143 0.28
144 0.25
145 0.27
146 0.25
147 0.24
148 0.19
149 0.18
150 0.13
151 0.11
152 0.11
153 0.08
154 0.08
155 0.07
156 0.06
157 0.05
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.02
169 0.03
170 0.04
171 0.05
172 0.05
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06
179 0.08
180 0.09
181 0.09
182 0.09
183 0.09
184 0.09
185 0.09
186 0.07
187 0.05
188 0.05
189 0.05
190 0.04
191 0.04
192 0.05
193 0.05
194 0.05
195 0.05
196 0.05
197 0.04
198 0.05
199 0.05
200 0.04
201 0.04
202 0.05
203 0.05
204 0.12
205 0.12
206 0.13
207 0.13
208 0.13
209 0.14
210 0.14
211 0.19
212 0.14
213 0.16
214 0.2
215 0.2
216 0.21
217 0.2
218 0.2
219 0.18
220 0.2
221 0.24
222 0.21
223 0.22
224 0.22
225 0.22
226 0.22
227 0.19
228 0.18
229 0.15
230 0.13
231 0.12
232 0.12
233 0.13
234 0.13
235 0.13
236 0.16
237 0.16
238 0.16
239 0.18
240 0.18
241 0.2
242 0.22
243 0.23