Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5G8E6

Protein Details
Accession C5G8E6   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-40VLRIIKTRERCHRLKREEKKQKLAEKKRIEABasic
NLS Segment(s)
PositionSequence
21-37HRLKREEKKQKLAEKKR
Subcellular Location(s) mito 19.5, cyto_mito 11, nucl 5
Family & Domain DBs
Amino Acid Sequences MSFLFKYSAVLRIIKTRERCHRLKREEKKQKLAEKKRIEALFRSQMHFIIQNIEKTALLSEYANLLAAEVEPETVDQEMRDFRVQVDLTEKEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.47
4 0.55
5 0.6
6 0.67
7 0.7
8 0.75
9 0.79
10 0.83
11 0.85
12 0.86
13 0.89
14 0.9
15 0.9
16 0.87
17 0.86
18 0.86
19 0.86
20 0.85
21 0.81
22 0.76
23 0.73
24 0.67
25 0.6
26 0.51
27 0.48
28 0.46
29 0.4
30 0.38
31 0.31
32 0.28
33 0.27
34 0.25
35 0.19
36 0.15
37 0.16
38 0.15
39 0.15
40 0.15
41 0.14
42 0.13
43 0.14
44 0.08
45 0.08
46 0.07
47 0.06
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.05
60 0.05
61 0.06
62 0.06
63 0.06
64 0.08
65 0.1
66 0.14
67 0.16
68 0.15
69 0.16
70 0.23
71 0.23
72 0.23
73 0.27