Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GXY3

Protein Details
Accession C5GXY3    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
90-115QSQKSFRTKQKLAKAQKQNRPIPQWIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPKPTLNNLIRMSPSRAPIISRDSAQHAKPDHALDRQDAGMCEILTATDSLPVPSPYVDRPLAGAAPPPPPLLLLLVRIEMTANLGSEIQSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.34
4 0.32
5 0.32
6 0.35
7 0.31
8 0.28
9 0.28
10 0.31
11 0.35
12 0.34
13 0.36
14 0.31
15 0.31
16 0.32
17 0.34
18 0.31
19 0.3
20 0.31
21 0.26
22 0.27
23 0.25
24 0.24
25 0.2
26 0.18
27 0.15
28 0.13
29 0.11
30 0.09
31 0.08
32 0.07
33 0.07
34 0.05
35 0.06
36 0.06
37 0.07
38 0.08
39 0.09
40 0.09
41 0.09
42 0.1
43 0.09
44 0.13
45 0.13
46 0.12
47 0.12
48 0.12
49 0.12
50 0.11
51 0.11
52 0.09
53 0.1
54 0.11
55 0.11
56 0.1
57 0.1
58 0.1
59 0.1
60 0.09
61 0.09
62 0.09
63 0.1
64 0.1
65 0.09
66 0.09
67 0.07
68 0.08
69 0.07
70 0.06
71 0.06
72 0.06
73 0.07
74 0.1
75 0.12
76 0.12
77 0.14
78 0.15
79 0.18
80 0.26
81 0.32
82 0.36
83 0.45
84 0.5
85 0.57
86 0.67
87 0.74
88 0.76
89 0.8
90 0.83
91 0.84
92 0.86
93 0.87
94 0.85
95 0.84
96 0.8
97 0.79
98 0.75
99 0.74
100 0.75
101 0.7
102 0.68
103 0.64
104 0.61