Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GRK9

Protein Details
Accession C5GRK9   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-29ARGGRACKSKSKTKRIERGLMIHydrophilic
NLS Segment(s)
PositionSequence
41-50EGEKKKRVEK
Subcellular Location(s) mito 14.5, mito_nucl 12.833, nucl 10, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MYVWMMQARGGRACKSKSKTKRIERGLMIMEVEIGKIRIGEGEKKKRVEKRETEQTNKRGCSGFGSWGWAWLGATGTTHNTHHTNNQRYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.55
4 0.6
5 0.68
6 0.74
7 0.78
8 0.84
9 0.82
10 0.84
11 0.76
12 0.71
13 0.63
14 0.53
15 0.43
16 0.32
17 0.25
18 0.16
19 0.14
20 0.08
21 0.06
22 0.05
23 0.04
24 0.04
25 0.06
26 0.07
27 0.15
28 0.24
29 0.33
30 0.38
31 0.41
32 0.47
33 0.51
34 0.56
35 0.58
36 0.57
37 0.56
38 0.62
39 0.66
40 0.69
41 0.72
42 0.73
43 0.71
44 0.64
45 0.57
46 0.48
47 0.41
48 0.38
49 0.32
50 0.28
51 0.21
52 0.26
53 0.24
54 0.24
55 0.24
56 0.19
57 0.17
58 0.13
59 0.14
60 0.08
61 0.09
62 0.08
63 0.11
64 0.13
65 0.14
66 0.17
67 0.19
68 0.22
69 0.31
70 0.4