Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5GU21

Protein Details
Accession C5GU21    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-81VIITSDEKKKKEKKKKKKKNEKBasic
NLS Segment(s)
PositionSequence
67-81KKKKEKKKKKKKNEK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MIQNIEKTALLSEHVNLLTAEMKSETVDQKMWDFEIQIDLAEREQQKPFSEKIVKRDFEVIITSDEKKKKEKKKKKKKNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.12
4 0.13
5 0.14
6 0.12
7 0.13
8 0.09
9 0.1
10 0.1
11 0.13
12 0.13
13 0.12
14 0.13
15 0.13
16 0.14
17 0.14
18 0.15
19 0.12
20 0.11
21 0.09
22 0.1
23 0.09
24 0.08
25 0.07
26 0.07
27 0.06
28 0.1
29 0.1
30 0.11
31 0.13
32 0.14
33 0.16
34 0.19
35 0.19
36 0.23
37 0.31
38 0.32
39 0.4
40 0.47
41 0.46
42 0.45
43 0.48
44 0.41
45 0.33
46 0.32
47 0.25
48 0.19
49 0.21
50 0.22
51 0.26
52 0.3
53 0.31
54 0.39
55 0.47
56 0.55
57 0.64
58 0.73
59 0.77
60 0.84
61 0.93