Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094IDP3

Protein Details
Accession A0A094IDP3    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
191-227KLCTAGAKKICRKIRKAKKKKGKKGKKGKKASGCLTGBasic
NLS Segment(s)
PositionSequence
198-221KKICRKIRKAKKKKGKKGKKGKKA
Subcellular Location(s) cyto 13.5, cyto_mito 10.333, nucl 7.5, mito_nucl 7.333, mito 6
Family & Domain DBs
Amino Acid Sequences MGKMSPVDKAALRKRLQEIKESIELCATAPFSRVLQMPQEELKKLMLNIGEQRPTREPGNTMRREVMKLQGLKFRAFCRYAQIWDTVGKQYEAMDAAEARLHNHRGATVAELLAAIDVLKKYLATSDKILEHGFDLIKMLHDDEALTLRQLVSAQAEATVHRQDRVFYLIEASHVTISIVKFCEAVSKPFKLCTAGAKKICRKIRKAKKKKGKKGKKGKKASGCLTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.61
4 0.61
5 0.57
6 0.54
7 0.59
8 0.53
9 0.45
10 0.37
11 0.35
12 0.26
13 0.24
14 0.19
15 0.12
16 0.13
17 0.13
18 0.12
19 0.15
20 0.16
21 0.15
22 0.19
23 0.21
24 0.23
25 0.27
26 0.3
27 0.28
28 0.28
29 0.28
30 0.25
31 0.23
32 0.23
33 0.19
34 0.19
35 0.25
36 0.28
37 0.33
38 0.31
39 0.35
40 0.35
41 0.37
42 0.36
43 0.31
44 0.29
45 0.33
46 0.43
47 0.42
48 0.41
49 0.43
50 0.43
51 0.44
52 0.42
53 0.39
54 0.35
55 0.35
56 0.35
57 0.36
58 0.36
59 0.36
60 0.36
61 0.32
62 0.31
63 0.29
64 0.26
65 0.28
66 0.29
67 0.29
68 0.28
69 0.28
70 0.23
71 0.24
72 0.25
73 0.2
74 0.18
75 0.16
76 0.14
77 0.13
78 0.12
79 0.11
80 0.09
81 0.07
82 0.06
83 0.06
84 0.08
85 0.07
86 0.08
87 0.1
88 0.11
89 0.11
90 0.11
91 0.11
92 0.11
93 0.12
94 0.12
95 0.1
96 0.08
97 0.08
98 0.07
99 0.07
100 0.05
101 0.05
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.04
109 0.07
110 0.09
111 0.1
112 0.12
113 0.15
114 0.15
115 0.17
116 0.17
117 0.14
118 0.13
119 0.13
120 0.11
121 0.08
122 0.08
123 0.07
124 0.07
125 0.08
126 0.08
127 0.06
128 0.06
129 0.06
130 0.06
131 0.08
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.07
141 0.07
142 0.07
143 0.08
144 0.08
145 0.11
146 0.15
147 0.14
148 0.15
149 0.15
150 0.16
151 0.17
152 0.2
153 0.18
154 0.13
155 0.15
156 0.14
157 0.15
158 0.15
159 0.14
160 0.11
161 0.1
162 0.1
163 0.1
164 0.1
165 0.12
166 0.12
167 0.12
168 0.12
169 0.12
170 0.2
171 0.19
172 0.25
173 0.27
174 0.31
175 0.31
176 0.33
177 0.35
178 0.3
179 0.3
180 0.33
181 0.37
182 0.41
183 0.47
184 0.55
185 0.61
186 0.67
187 0.75
188 0.74
189 0.75
190 0.77
191 0.82
192 0.84
193 0.88
194 0.9
195 0.92
196 0.95
197 0.96
198 0.97
199 0.97
200 0.96
201 0.97
202 0.96
203 0.96
204 0.96
205 0.95
206 0.94
207 0.92