Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094GSH8

Protein Details
Accession A0A094GSH8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
30-53TKGARRWWCCGRRRRTRVQPDYDAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 5, pero 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MFLALLSLAAIHPGRYLRGPGSEFAKPIVTKGARRWWCCGRRRRTRVQPDYDAPKTETTPQSDGEYNRHGDRTSDVPLTALSDGVYDRRDSRMSDVPRTAQFPYRERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.16
4 0.15
5 0.2
6 0.22
7 0.22
8 0.26
9 0.26
10 0.25
11 0.24
12 0.27
13 0.22
14 0.21
15 0.26
16 0.24
17 0.26
18 0.31
19 0.4
20 0.42
21 0.45
22 0.5
23 0.52
24 0.58
25 0.64
26 0.68
27 0.68
28 0.72
29 0.77
30 0.82
31 0.83
32 0.85
33 0.85
34 0.83
35 0.78
36 0.72
37 0.72
38 0.63
39 0.55
40 0.45
41 0.37
42 0.3
43 0.29
44 0.27
45 0.22
46 0.22
47 0.22
48 0.23
49 0.24
50 0.25
51 0.24
52 0.24
53 0.23
54 0.22
55 0.22
56 0.2
57 0.18
58 0.19
59 0.19
60 0.2
61 0.18
62 0.17
63 0.16
64 0.16
65 0.17
66 0.15
67 0.11
68 0.08
69 0.07
70 0.08
71 0.09
72 0.1
73 0.1
74 0.11
75 0.14
76 0.16
77 0.17
78 0.23
79 0.3
80 0.34
81 0.4
82 0.43
83 0.44
84 0.46
85 0.48
86 0.45
87 0.44
88 0.45