Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179TWB0

Protein Details
Accession A0A179TWB0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-39LRIIKARECCHRLKREKKKYRNNADDATCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, nucl 13, cyto_mito 7.5
Family & Domain DBs
Amino Acid Sequences MSSLFKYSAVLRIIKARECCHRLKREKKKYRNNADDATCERLKKKTNIEKTVLLSEHVNLLTAEVEPETADQKMWDFEMQVDLAEEKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.36
4 0.42
5 0.45
6 0.52
7 0.54
8 0.61
9 0.67
10 0.73
11 0.8
12 0.83
13 0.89
14 0.91
15 0.93
16 0.93
17 0.94
18 0.92
19 0.87
20 0.82
21 0.73
22 0.67
23 0.59
24 0.54
25 0.44
26 0.36
27 0.31
28 0.29
29 0.31
30 0.31
31 0.38
32 0.41
33 0.49
34 0.54
35 0.56
36 0.55
37 0.53
38 0.52
39 0.43
40 0.35
41 0.26
42 0.2
43 0.19
44 0.15
45 0.13
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.05
52 0.06
53 0.05
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.09
60 0.1
61 0.11
62 0.11
63 0.11
64 0.11
65 0.14
66 0.14
67 0.13
68 0.13