Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GTC9

Protein Details
Accession C5GTC9   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22SITYKRLKKRIQELIEKKRIKAHydrophilic
NLS Segment(s)
PositionSequence
92-99KKKKKNKK
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences SITYKRLKKRIQELIEKKRIKALFRHGHTVSLALLSEYVNLLITEVKPETADQKMRDFEAQIDLTEEKQQKLFSEKTVKRDFEMIITSDEEKKKKKNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.8
4 0.7
5 0.68
6 0.62
7 0.55
8 0.51
9 0.51
10 0.51
11 0.52
12 0.59
13 0.52
14 0.5
15 0.47
16 0.4
17 0.29
18 0.2
19 0.16
20 0.09
21 0.08
22 0.06
23 0.06
24 0.05
25 0.05
26 0.04
27 0.04
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.06
34 0.06
35 0.07
36 0.09
37 0.11
38 0.15
39 0.15
40 0.18
41 0.19
42 0.2
43 0.21
44 0.19
45 0.17
46 0.18
47 0.17
48 0.13
49 0.15
50 0.14
51 0.14
52 0.2
53 0.21
54 0.17
55 0.18
56 0.18
57 0.18
58 0.23
59 0.24
60 0.24
61 0.34
62 0.37
63 0.44
64 0.52
65 0.52
66 0.48
67 0.49
68 0.43
69 0.36
70 0.35
71 0.28
72 0.22
73 0.23
74 0.24
75 0.27
76 0.32
77 0.35
78 0.38
79 0.47