Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094H558

Protein Details
Accession A0A094H558    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
11-32SPRTEFSRLRRRRHAHNAAPSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MLNPPAAGCLSPRTEFSRLRRRRHAHNAAPSTPALADDLFDIRHDPPCQLCRRYITTYPAVSRAPGGLHRGGSMSGWEEEAEEEVHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.45
4 0.51
5 0.56
6 0.63
7 0.71
8 0.7
9 0.75
10 0.8
11 0.81
12 0.79
13 0.8
14 0.78
15 0.69
16 0.66
17 0.55
18 0.45
19 0.34
20 0.26
21 0.16
22 0.1
23 0.08
24 0.06
25 0.07
26 0.06
27 0.06
28 0.08
29 0.07
30 0.11
31 0.11
32 0.11
33 0.14
34 0.2
35 0.25
36 0.26
37 0.28
38 0.29
39 0.34
40 0.39
41 0.4
42 0.39
43 0.39
44 0.4
45 0.39
46 0.38
47 0.33
48 0.28
49 0.24
50 0.2
51 0.16
52 0.16
53 0.18
54 0.17
55 0.17
56 0.17
57 0.18
58 0.17
59 0.16
60 0.14
61 0.13
62 0.11
63 0.12
64 0.11
65 0.11
66 0.11
67 0.12