Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094HY23

Protein Details
Accession A0A094HY23    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
71-102QTESTQKKSTQKKSTAQKKPAEKKSTQKKPKKHydrophilic
NLS Segment(s)
PositionSequence
80-102TQKKSTAQKKPAEKKSTQKKPKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSSQQQNIGNTGGNASANAEASTKFSYAALATTPLGPTYNPFAEWEANVSRRDNPMTDFLFESVAVEEPAQTESTQKKSTQKKSTAQKKPAEKKSTQKKPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.1
5 0.1
6 0.1
7 0.09
8 0.11
9 0.13
10 0.12
11 0.11
12 0.1
13 0.11
14 0.1
15 0.11
16 0.08
17 0.08
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.08
24 0.09
25 0.12
26 0.12
27 0.12
28 0.13
29 0.14
30 0.14
31 0.14
32 0.16
33 0.14
34 0.15
35 0.16
36 0.16
37 0.16
38 0.18
39 0.19
40 0.16
41 0.16
42 0.18
43 0.18
44 0.19
45 0.17
46 0.16
47 0.16
48 0.15
49 0.13
50 0.09
51 0.08
52 0.07
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.1
60 0.14
61 0.19
62 0.22
63 0.25
64 0.33
65 0.43
66 0.53
67 0.59
68 0.64
69 0.67
70 0.75
71 0.82
72 0.84
73 0.83
74 0.82
75 0.83
76 0.86
77 0.87
78 0.84
79 0.81
80 0.81
81 0.83
82 0.86