Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094HW30

Protein Details
Accession A0A094HW30    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-34ALPQRPIIPVKKPHRKRKSDQDNAQTGQHHydrophilic
189-235VKERAKMKMKEGSKKRRRRSSTLEVDERKREKRVKRESFGKKRGSPEBasic
NLS Segment(s)
PositionSequence
16-23KKPHRKRK
186-250RLKVKERAKMKMKEGSKKRRRRSSTLEVDERKREKRVKRESFGKKRGSPEAEVEGKEERKRRRRV
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
Amino Acid Sequences MTDSMALPQRPIIPVKKPHRKRKSDQDNAQTGQHDQKGPAQDETSDDWWTEIIHQHHTLLTSHSRILSAILKTSPPASARHETISKFLTQTRDMLGQVGGVESSTKRRRSNGSDILREPGAKRRNAGEEEEADLLSPSPSPSGEESGTASHSVPVQGGKKMRVERATPLREVEVEVDDLRAEVEARLKVKERAKMKMKEGSKKRRRRSSTLEVDERKREKRVKRESFGKKRGSPEAEVEGKEERKRRRRVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.55
3 0.63
4 0.71
5 0.79
6 0.85
7 0.89
8 0.9
9 0.91
10 0.92
11 0.92
12 0.91
13 0.9
14 0.87
15 0.8
16 0.74
17 0.64
18 0.55
19 0.51
20 0.46
21 0.37
22 0.3
23 0.33
24 0.37
25 0.38
26 0.37
27 0.32
28 0.27
29 0.29
30 0.32
31 0.29
32 0.23
33 0.2
34 0.18
35 0.17
36 0.16
37 0.15
38 0.16
39 0.15
40 0.19
41 0.2
42 0.2
43 0.21
44 0.22
45 0.21
46 0.19
47 0.21
48 0.18
49 0.19
50 0.19
51 0.18
52 0.17
53 0.18
54 0.19
55 0.16
56 0.16
57 0.16
58 0.16
59 0.16
60 0.17
61 0.17
62 0.14
63 0.16
64 0.2
65 0.23
66 0.25
67 0.28
68 0.31
69 0.29
70 0.31
71 0.3
72 0.25
73 0.22
74 0.23
75 0.22
76 0.2
77 0.2
78 0.19
79 0.2
80 0.18
81 0.18
82 0.15
83 0.11
84 0.1
85 0.09
86 0.07
87 0.04
88 0.05
89 0.05
90 0.12
91 0.18
92 0.23
93 0.24
94 0.28
95 0.34
96 0.4
97 0.49
98 0.52
99 0.53
100 0.53
101 0.52
102 0.51
103 0.46
104 0.4
105 0.31
106 0.3
107 0.28
108 0.24
109 0.24
110 0.24
111 0.28
112 0.3
113 0.31
114 0.25
115 0.21
116 0.22
117 0.22
118 0.19
119 0.14
120 0.12
121 0.1
122 0.07
123 0.06
124 0.04
125 0.04
126 0.04
127 0.06
128 0.07
129 0.1
130 0.1
131 0.1
132 0.11
133 0.12
134 0.12
135 0.12
136 0.11
137 0.09
138 0.09
139 0.08
140 0.08
141 0.1
142 0.11
143 0.14
144 0.17
145 0.18
146 0.24
147 0.27
148 0.31
149 0.32
150 0.32
151 0.36
152 0.44
153 0.45
154 0.4
155 0.39
156 0.35
157 0.31
158 0.3
159 0.24
160 0.16
161 0.13
162 0.12
163 0.11
164 0.1
165 0.09
166 0.08
167 0.07
168 0.06
169 0.05
170 0.09
171 0.11
172 0.13
173 0.15
174 0.18
175 0.24
176 0.29
177 0.36
178 0.37
179 0.43
180 0.52
181 0.56
182 0.6
183 0.62
184 0.64
185 0.67
186 0.73
187 0.75
188 0.77
189 0.8
190 0.85
191 0.87
192 0.88
193 0.86
194 0.85
195 0.85
196 0.85
197 0.84
198 0.84
199 0.8
200 0.78
201 0.78
202 0.75
203 0.69
204 0.66
205 0.65
206 0.65
207 0.69
208 0.74
209 0.75
210 0.78
211 0.84
212 0.87
213 0.9
214 0.9
215 0.89
216 0.84
217 0.8
218 0.8
219 0.75
220 0.67
221 0.61
222 0.6
223 0.55
224 0.5
225 0.46
226 0.43
227 0.43
228 0.46
229 0.49
230 0.51
231 0.56