FuNGI

A0A094H648

Protein Details

Accession

A0A094H648

Localization Confidence

Medium

Confidence Score

12.6

NoLS Segment(s)

Position	Sequence	Protein Nature
573-609	EMWAISVKRQRKLKMKKHKYKKLMRRTRNLRRRLDRN	Basic

NLS Segment(s)

Position	Sequence
346-359	AKKKTQRTRKAKGA
580-609	KRQRKLKMKKHKYKKLMRRTRNLRRRLDRN

Subcellular Location(s)

nucl 8, cyto 8, cyto_nucl 8, mito 7

Family & Domain DBs

InterPro	View protein in InterPro IPR013177 COX24_C IPR027417 P-loop_NTPase IPR006689 Small_GTPase_ARF/SAR
Gene Ontology	GO:0005525 F:GTP binding GO:0003924 F:GTPase activity
Pfam	View protein in Pfam PF00025 Arf PF08213 COX24_C

Amino Acid Sequences

MFSALEMASAIAKFLSPILGPRQHRKIAIIGLDDAGGIDLLKRLCGTRIEEKRGGRGLLVHTGTKSTLKCDFDFVVVEVGGSAPARYLLWMSAQFHDADGFIWVLDSADTDRFEESRVEMGYARMGRRLNRGGTYQDGDQPSVDPEKPWLVLVDFKQNPLSIAEATRQAERVITDAGDNLDSTFRAVSITNSEGLSEAMGWLYKKFYKFVVIPVSGVCTHNFSATTSRQSRDTPRAFALRRLESKTSEMEPSHLQPQQPRLPQPPRAGRAMFTSSVRRAAFAAQPSPIAASLATSFPRAVSTQSLSCRPLQRRYSSSKPSSPADGSKGVAEGSVPATPAQTRSEGAKKKTQRTRKAKGAAAHTVKGRDEAFDNLPSVPSTHHLQVKDIAASTFFSLHRPISVTSPFPKPITTSAFASIFATHPPHRVADVLSTLSSTVRALDGNPTHDSFGADETLRAALAAEPNDITHLDAQDAIPFPQHILTGRYQPFNAPPAPVPMPVDAAPVAAETAQAKRTYTATLTIEESTSPLGEVTYVATSGPLHDVAEPTVPTAFRERMRERRLRYVEERAGGEMWAISVKRQRKLKMKKHKYKKLMRRTRNLRRRLDRN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.07
2	0.09
3	0.08
4	0.12
5	0.2
6	0.29
7	0.34
8	0.43
9	0.51
10	0.54
11	0.56
12	0.55
13	0.53
14	0.5
15	0.5
16	0.44
17	0.37
18	0.32
19	0.3
20	0.27
21	0.21
22	0.14
23	0.09
24	0.06
25	0.05
26	0.08
27	0.08
28	0.09
29	0.1
30	0.11
31	0.14
32	0.18
33	0.24
34	0.31
35	0.41
36	0.48
37	0.54
38	0.56
39	0.6
40	0.6
41	0.55
42	0.45
43	0.4
44	0.36
45	0.37
46	0.37
47	0.32
48	0.28
49	0.29
50	0.29
51	0.3
52	0.26
53	0.23
54	0.27
55	0.29
56	0.3
57	0.33
58	0.32
59	0.29
60	0.3
61	0.27
62	0.22
63	0.18
64	0.17
65	0.12
66	0.11
67	0.1
68	0.08
69	0.07
70	0.05
71	0.06
72	0.06
73	0.06
74	0.07
75	0.07
76	0.11
77	0.15
78	0.18
79	0.19
80	0.2
81	0.2
82	0.19
83	0.19
84	0.15
85	0.12
86	0.1
87	0.08
88	0.07
89	0.06
90	0.06
91	0.06
92	0.05
93	0.06
94	0.07
95	0.09
96	0.1
97	0.11
98	0.12
99	0.12
100	0.14
101	0.14
102	0.14
103	0.15
104	0.15
105	0.16
106	0.15
107	0.16
108	0.2
109	0.22
110	0.22
111	0.22
112	0.24
113	0.26
114	0.33
115	0.38
116	0.36
117	0.36
118	0.38
119	0.37
120	0.39
121	0.39
122	0.33
123	0.33
124	0.31
125	0.29
126	0.26
127	0.23
128	0.21
129	0.23
130	0.21
131	0.15
132	0.16
133	0.18
134	0.18
135	0.18
136	0.16
137	0.13
138	0.18
139	0.19
140	0.27
141	0.25
142	0.26
143	0.27
144	0.26
145	0.26
146	0.22
147	0.22
148	0.13
149	0.14
150	0.14
151	0.17
152	0.19
153	0.19
154	0.18
155	0.17
156	0.17
157	0.15
158	0.15
159	0.12
160	0.11
161	0.1
162	0.1
163	0.11
164	0.1
165	0.1
166	0.08
167	0.08
168	0.07
169	0.08
170	0.07
171	0.06
172	0.07
173	0.07
174	0.07
175	0.11
176	0.12
177	0.13
178	0.13
179	0.13
180	0.12
181	0.12
182	0.11
183	0.07
184	0.06
185	0.04
186	0.05
187	0.06
188	0.06
189	0.09
190	0.12
191	0.13
192	0.14
193	0.15
194	0.19
195	0.2
196	0.25
197	0.29
198	0.27
199	0.27
200	0.25
201	0.27
202	0.23
203	0.23
204	0.18
205	0.14
206	0.13
207	0.14
208	0.14
209	0.12
210	0.16
211	0.18
212	0.25
213	0.25
214	0.26
215	0.27
216	0.3
217	0.35
218	0.4
219	0.41
220	0.37
221	0.37
222	0.44
223	0.42
224	0.45
225	0.45
226	0.41
227	0.42
228	0.44
229	0.42
230	0.37
231	0.38
232	0.35
233	0.3
234	0.28
235	0.24
236	0.21
237	0.21
238	0.21
239	0.24
240	0.23
241	0.23
242	0.22
243	0.29
244	0.34
245	0.36
246	0.38
247	0.41
248	0.45
249	0.51
250	0.56
251	0.57
252	0.52
253	0.52
254	0.49
255	0.41
256	0.4
257	0.36
258	0.29
259	0.23
260	0.24
261	0.21
262	0.26
263	0.25
264	0.21
265	0.18
266	0.19
267	0.2
268	0.19
269	0.19
270	0.14
271	0.14
272	0.14
273	0.14
274	0.11
275	0.08
276	0.06
277	0.05
278	0.05
279	0.07
280	0.07
281	0.07
282	0.07
283	0.07
284	0.08
285	0.08
286	0.08
287	0.09
288	0.11
289	0.14
290	0.16
291	0.18
292	0.19
293	0.22
294	0.27
295	0.29
296	0.36
297	0.38
298	0.41
299	0.43
300	0.49
301	0.54
302	0.56
303	0.57
304	0.53
305	0.51
306	0.48
307	0.46
308	0.4
309	0.34
310	0.3
311	0.26
312	0.22
313	0.19
314	0.18
315	0.14
316	0.12
317	0.1
318	0.07
319	0.06
320	0.06
321	0.06
322	0.06
323	0.07
324	0.07
325	0.09
326	0.09
327	0.09
328	0.1
329	0.13
330	0.21
331	0.26
332	0.3
333	0.37
334	0.42
335	0.51
336	0.59
337	0.65
338	0.68
339	0.73
340	0.78
341	0.79
342	0.79
343	0.75
344	0.71
345	0.67
346	0.64
347	0.58
348	0.52
349	0.44
350	0.39
351	0.34
352	0.31
353	0.25
354	0.17
355	0.16
356	0.16
357	0.17
358	0.16
359	0.17
360	0.15
361	0.15
362	0.14
363	0.13
364	0.1
365	0.11
366	0.12
367	0.16
368	0.2
369	0.2
370	0.21
371	0.24
372	0.25
373	0.23
374	0.2
375	0.16
376	0.13
377	0.13
378	0.12
379	0.11
380	0.1
381	0.1
382	0.12
383	0.12
384	0.12
385	0.13
386	0.14
387	0.15
388	0.17
389	0.19
390	0.21
391	0.25
392	0.27
393	0.25
394	0.25
395	0.23
396	0.25
397	0.28
398	0.27
399	0.24
400	0.25
401	0.25
402	0.25
403	0.24
404	0.2
405	0.15
406	0.14
407	0.16
408	0.14
409	0.16
410	0.17
411	0.17
412	0.17
413	0.18
414	0.17
415	0.15
416	0.16
417	0.15
418	0.13
419	0.13
420	0.12
421	0.12
422	0.11
423	0.08
424	0.07
425	0.06
426	0.06
427	0.07
428	0.13
429	0.15
430	0.19
431	0.21
432	0.21
433	0.21
434	0.22
435	0.22
436	0.16
437	0.15
438	0.14
439	0.11
440	0.11
441	0.11
442	0.11
443	0.1
444	0.09
445	0.08
446	0.07
447	0.1
448	0.1
449	0.1
450	0.1
451	0.1
452	0.12
453	0.11
454	0.11
455	0.1
456	0.1
457	0.09
458	0.1
459	0.1
460	0.12
461	0.13
462	0.13
463	0.12
464	0.11
465	0.12
466	0.12
467	0.13
468	0.11
469	0.14
470	0.16
471	0.24
472	0.27
473	0.29
474	0.29
475	0.3
476	0.32
477	0.33
478	0.32
479	0.26
480	0.23
481	0.27
482	0.29
483	0.28
484	0.27
485	0.23
486	0.24
487	0.22
488	0.23
489	0.16
490	0.15
491	0.13
492	0.11
493	0.1
494	0.07
495	0.08
496	0.07
497	0.1
498	0.13
499	0.14
500	0.14
501	0.16
502	0.17
503	0.19
504	0.19
505	0.22
506	0.21
507	0.22
508	0.24
509	0.23
510	0.22
511	0.2
512	0.19
513	0.14
514	0.12
515	0.1
516	0.08
517	0.07
518	0.07
519	0.07
520	0.08
521	0.08
522	0.08
523	0.07
524	0.08
525	0.08
526	0.09
527	0.11
528	0.1
529	0.1
530	0.11
531	0.12
532	0.13
533	0.16
534	0.15
535	0.14
536	0.16
537	0.15
538	0.16
539	0.2
540	0.24
541	0.25
542	0.34
543	0.42
544	0.5
545	0.59
546	0.67
547	0.67
548	0.73
549	0.76
550	0.75
551	0.74
552	0.74
553	0.71
554	0.67
555	0.62
556	0.53
557	0.47
558	0.38
559	0.32
560	0.21
561	0.15
562	0.14
563	0.12
564	0.14
565	0.21
566	0.28
567	0.35
568	0.43
569	0.51
570	0.58
571	0.69
572	0.77
573	0.81
574	0.86
575	0.89
576	0.93
577	0.95
578	0.95
579	0.95
580	0.95
581	0.95
582	0.95
583	0.94
584	0.94
585	0.94
586	0.95
587	0.94
588	0.93
589	0.93

A0A094H648

3D AlphaFold-predicted Structure Viewer