Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094HZU4

Protein Details
Accession A0A094HZU4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
85-114VKATVHRRLKCSKKSPSPKLKQHKIAMKAIHydrophilic
NLS Segment(s)
PositionSequence
97-107KKSPSPKLKQH
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MSAPTYNPLLLPKRDILFSQRSAVTGPAHGVEEKVTSEGTVEDITEFGDVTLPAFRDCECISPDAQGLWFKIGCRHGRWGEACRVKATVHRRLKCSKKSPSPKLKQHKIAMKAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.33
4 0.34
5 0.34
6 0.34
7 0.3
8 0.29
9 0.28
10 0.29
11 0.24
12 0.18
13 0.16
14 0.13
15 0.13
16 0.13
17 0.12
18 0.1
19 0.1
20 0.1
21 0.1
22 0.08
23 0.07
24 0.07
25 0.07
26 0.08
27 0.07
28 0.06
29 0.05
30 0.06
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.09
44 0.09
45 0.11
46 0.1
47 0.11
48 0.11
49 0.12
50 0.12
51 0.1
52 0.11
53 0.1
54 0.09
55 0.1
56 0.1
57 0.1
58 0.14
59 0.19
60 0.22
61 0.23
62 0.3
63 0.29
64 0.35
65 0.38
66 0.39
67 0.42
68 0.46
69 0.44
70 0.39
71 0.39
72 0.34
73 0.38
74 0.4
75 0.41
76 0.45
77 0.49
78 0.54
79 0.62
80 0.71
81 0.75
82 0.77
83 0.77
84 0.78
85 0.83
86 0.89
87 0.9
88 0.91
89 0.91
90 0.93
91 0.93
92 0.91
93 0.89
94 0.88