Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094ICQ1

Protein Details
Accession A0A094ICQ1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSNVRKRQSQNASRRRRTLTNKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MSNVRKRQSQNASRRRRTLTNKVYEYEELYGADVALVIYQKGRYYTYVSSGNPCFPPSKKEIMNSFPIPINMLPHDADAKYQRKRNSEDPEQVGNTEKGCADTNIATALRRQDEASSLSGPMNPYQSQVHTSESNMLPRLALDSAEVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.81
4 0.8
5 0.8
6 0.79
7 0.78
8 0.74
9 0.69
10 0.66
11 0.58
12 0.52
13 0.42
14 0.33
15 0.23
16 0.19
17 0.17
18 0.12
19 0.11
20 0.08
21 0.05
22 0.05
23 0.05
24 0.04
25 0.05
26 0.06
27 0.07
28 0.08
29 0.1
30 0.11
31 0.15
32 0.16
33 0.2
34 0.24
35 0.24
36 0.27
37 0.27
38 0.29
39 0.25
40 0.25
41 0.24
42 0.2
43 0.24
44 0.23
45 0.28
46 0.28
47 0.32
48 0.35
49 0.36
50 0.41
51 0.37
52 0.34
53 0.28
54 0.26
55 0.23
56 0.18
57 0.16
58 0.11
59 0.11
60 0.1
61 0.1
62 0.11
63 0.09
64 0.11
65 0.16
66 0.22
67 0.25
68 0.3
69 0.34
70 0.38
71 0.43
72 0.51
73 0.53
74 0.54
75 0.56
76 0.56
77 0.55
78 0.5
79 0.46
80 0.4
81 0.32
82 0.24
83 0.18
84 0.14
85 0.12
86 0.12
87 0.12
88 0.11
89 0.11
90 0.11
91 0.13
92 0.13
93 0.12
94 0.13
95 0.16
96 0.16
97 0.17
98 0.17
99 0.15
100 0.17
101 0.19
102 0.2
103 0.17
104 0.17
105 0.16
106 0.17
107 0.18
108 0.17
109 0.19
110 0.16
111 0.18
112 0.19
113 0.21
114 0.22
115 0.23
116 0.26
117 0.23
118 0.24
119 0.28
120 0.29
121 0.31
122 0.3
123 0.28
124 0.23
125 0.22
126 0.24
127 0.17
128 0.15