Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094HPX2

Protein Details
Accession A0A094HPX2    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
59-84ETAALKDRRREKKEKGEGYKDKNKTSBasic
NLS Segment(s)
PositionSequence
64-76KDRRREKKEKGEG
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MKPEQSPGQADPSGVVDDHDHDHKKVTMSRCHEKVTNVTKVTKVIKVTSHVRRDKSGDETAALKDRRREKKEKGEGYKDKNKTSTSQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.11
4 0.12
5 0.15
6 0.2
7 0.2
8 0.19
9 0.22
10 0.23
11 0.26
12 0.3
13 0.33
14 0.35
15 0.41
16 0.49
17 0.49
18 0.5
19 0.49
20 0.45
21 0.47
22 0.46
23 0.45
24 0.39
25 0.37
26 0.35
27 0.36
28 0.37
29 0.31
30 0.25
31 0.2
32 0.2
33 0.23
34 0.29
35 0.34
36 0.41
37 0.43
38 0.44
39 0.45
40 0.47
41 0.46
42 0.44
43 0.39
44 0.31
45 0.27
46 0.27
47 0.26
48 0.3
49 0.29
50 0.25
51 0.29
52 0.38
53 0.47
54 0.53
55 0.6
56 0.62
57 0.72
58 0.8
59 0.84
60 0.83
61 0.84
62 0.86
63 0.87
64 0.87
65 0.82
66 0.77
67 0.72
68 0.65