Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179U0V1

Protein Details
Accession A0A179U0V1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-32GSYLNKGAAKRRKRFPVKPARYRTVVHydrophilic
NLS Segment(s)
PositionSequence
13-25GAAKRRKRFPVKP
Subcellular Location(s) mito 19, cyto 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MPGVCAGSYLNKGAAKRRKRFPVKPARYRTVVTDWEGREGDWLQTGRRHFDYGFDIKPTQRADRRKETDPGAGTEQGTNRRAHWLQPAETRQGVGPDKLSIPADVEKDHINHKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.53
4 0.61
5 0.68
6 0.76
7 0.83
8 0.84
9 0.86
10 0.86
11 0.88
12 0.88
13 0.83
14 0.76
15 0.69
16 0.63
17 0.58
18 0.51
19 0.43
20 0.41
21 0.35
22 0.35
23 0.34
24 0.29
25 0.24
26 0.22
27 0.19
28 0.16
29 0.16
30 0.13
31 0.17
32 0.18
33 0.2
34 0.2
35 0.21
36 0.18
37 0.19
38 0.24
39 0.24
40 0.24
41 0.22
42 0.21
43 0.2
44 0.24
45 0.23
46 0.24
47 0.27
48 0.33
49 0.38
50 0.47
51 0.52
52 0.52
53 0.54
54 0.52
55 0.51
56 0.45
57 0.41
58 0.34
59 0.3
60 0.27
61 0.25
62 0.25
63 0.24
64 0.25
65 0.23
66 0.2
67 0.26
68 0.26
69 0.27
70 0.33
71 0.33
72 0.35
73 0.42
74 0.45
75 0.43
76 0.43
77 0.41
78 0.33
79 0.33
80 0.31
81 0.24
82 0.22
83 0.2
84 0.2
85 0.22
86 0.22
87 0.17
88 0.18
89 0.2
90 0.2
91 0.19
92 0.2
93 0.21
94 0.22