Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094JT31

Protein Details
Accession A0A094JT31   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89MIRSNRKKAAKAKLPSKKKAHydrophilic
NLS Segment(s)
PositionSequence
74-89NRKKAAKAKLPSKKKA
Subcellular Location(s) plas 22, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLDKLVGLAMLLVASAVFLYYTIWTLLMPFVDPDQPIQHLFPPRVWAIRIPVIIILLGSALVGSFLSVVMIRSNRKKAAKAKLPSKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.06
15 0.06
16 0.06
17 0.07
18 0.08
19 0.08
20 0.09
21 0.1
22 0.11
23 0.12
24 0.12
25 0.15
26 0.17
27 0.18
28 0.17
29 0.19
30 0.18
31 0.18
32 0.18
33 0.15
34 0.15
35 0.18
36 0.17
37 0.15
38 0.14
39 0.13
40 0.12
41 0.11
42 0.07
43 0.04
44 0.03
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.03
55 0.04
56 0.07
57 0.11
58 0.16
59 0.23
60 0.29
61 0.36
62 0.41
63 0.48
64 0.54
65 0.62
66 0.67
67 0.7
68 0.75
69 0.79