Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094G983

Protein Details
Accession A0A094G983   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAVSKKKSGKPKSLSHGRPPTVHydrophilic
NLS Segment(s)
PositionSequence
5-21KKKSGKPKSLSHGRPPT
Subcellular Location(s) mito 13, nucl 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021867  Bmt2/SAMTOR  
Gene Ontology GO:0005730  C:nucleolus  
GO:0016433  F:rRNA (adenine) methyltransferase activity  
Pfam View protein in Pfam  
PF11968  Bmt2  
Amino Acid Sequences MAVSKKKSGKPKSLSHGRPPTVKPPPSLSSKATRTLIRAHHTLEKQKAIAQKAGDAIKVADLERQIQKQGGIEKYQAASLIGQGNERGGDSSKILMDWLKPIIPSLKVRTGEQKLRLLEVGALSTTNACSRSGLFDTERIDLNSQAQGITQQDFMERPLPKLSNEKFEIISLSLVLNYVPDAIARGEMLKRTLQFLRTPLGESEEELQTVFPALFLVLPAPCVSNSRYMDEPRLEAILASLGYVKVHKKLSNKLVYYLWRAVDLTPKVKREQFKKVEVRAGGARNNFAIIMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.85
4 0.79
5 0.79
6 0.74
7 0.74
8 0.73
9 0.69
10 0.63
11 0.59
12 0.59
13 0.59
14 0.59
15 0.53
16 0.52
17 0.52
18 0.55
19 0.52
20 0.5
21 0.45
22 0.47
23 0.5
24 0.46
25 0.45
26 0.42
27 0.46
28 0.5
29 0.55
30 0.53
31 0.51
32 0.46
33 0.47
34 0.49
35 0.44
36 0.43
37 0.35
38 0.32
39 0.32
40 0.33
41 0.29
42 0.23
43 0.2
44 0.17
45 0.18
46 0.15
47 0.13
48 0.12
49 0.17
50 0.2
51 0.22
52 0.22
53 0.22
54 0.22
55 0.23
56 0.29
57 0.28
58 0.25
59 0.25
60 0.26
61 0.25
62 0.25
63 0.22
64 0.16
65 0.12
66 0.12
67 0.15
68 0.13
69 0.12
70 0.12
71 0.12
72 0.12
73 0.12
74 0.1
75 0.08
76 0.09
77 0.09
78 0.1
79 0.1
80 0.1
81 0.1
82 0.1
83 0.09
84 0.1
85 0.11
86 0.11
87 0.1
88 0.11
89 0.13
90 0.15
91 0.18
92 0.21
93 0.26
94 0.27
95 0.28
96 0.35
97 0.39
98 0.42
99 0.43
100 0.44
101 0.38
102 0.38
103 0.37
104 0.29
105 0.24
106 0.18
107 0.13
108 0.08
109 0.07
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.06
116 0.07
117 0.07
118 0.1
119 0.11
120 0.13
121 0.13
122 0.15
123 0.17
124 0.17
125 0.18
126 0.15
127 0.15
128 0.13
129 0.14
130 0.12
131 0.1
132 0.08
133 0.07
134 0.08
135 0.08
136 0.09
137 0.08
138 0.07
139 0.08
140 0.08
141 0.09
142 0.14
143 0.14
144 0.14
145 0.17
146 0.18
147 0.19
148 0.28
149 0.28
150 0.29
151 0.31
152 0.31
153 0.28
154 0.27
155 0.27
156 0.19
157 0.17
158 0.1
159 0.08
160 0.07
161 0.06
162 0.06
163 0.04
164 0.04
165 0.04
166 0.03
167 0.03
168 0.04
169 0.04
170 0.05
171 0.05
172 0.06
173 0.07
174 0.08
175 0.1
176 0.12
177 0.12
178 0.16
179 0.18
180 0.19
181 0.2
182 0.21
183 0.23
184 0.21
185 0.23
186 0.2
187 0.22
188 0.2
189 0.18
190 0.19
191 0.16
192 0.15
193 0.13
194 0.13
195 0.09
196 0.09
197 0.08
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.05
204 0.05
205 0.06
206 0.06
207 0.07
208 0.07
209 0.1
210 0.11
211 0.18
212 0.2
213 0.23
214 0.27
215 0.29
216 0.34
217 0.34
218 0.34
219 0.27
220 0.26
221 0.22
222 0.18
223 0.16
224 0.12
225 0.1
226 0.08
227 0.08
228 0.07
229 0.08
230 0.11
231 0.12
232 0.15
233 0.2
234 0.25
235 0.3
236 0.39
237 0.49
238 0.56
239 0.56
240 0.55
241 0.56
242 0.56
243 0.56
244 0.52
245 0.42
246 0.34
247 0.33
248 0.3
249 0.33
250 0.33
251 0.35
252 0.37
253 0.4
254 0.44
255 0.49
256 0.57
257 0.56
258 0.62
259 0.62
260 0.67
261 0.73
262 0.74
263 0.75
264 0.68
265 0.66
266 0.62
267 0.59
268 0.55
269 0.48
270 0.43
271 0.36
272 0.36