Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5GFC2

Protein Details
Accession C5GFC2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
171-196NNESRIRSKKAHSMKKSKRRSSGYDDHydrophilic
NLS Segment(s)
PositionSequence
173-190ESRIRSKKAHSMKKSKRR
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016787  F:hydrolase activity  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
PROSITE View protein in PROSITE  
PS00745  RF_PROK_I  
Amino Acid Sequences MLQFPFTCTRTAFAARAFLPTLSARHLASSRSPSAQQFTDEELGTARIWLSQLTPRTIPRNIGEVSYSRSSGPGGQNVNKVNSKVTLKIPLSSILRLVPRALHAQIRSSRYIAERSDSLVIQSDETRKQTKNLDLCFEKLQELLVTAGKTAIPGETSPEQRKKVQALEKANNESRIRSKKAHSMKKSKRRSSGYDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.3
4 0.29
5 0.24
6 0.22
7 0.22
8 0.22
9 0.19
10 0.21
11 0.18
12 0.2
13 0.22
14 0.21
15 0.25
16 0.29
17 0.29
18 0.3
19 0.32
20 0.31
21 0.34
22 0.33
23 0.3
24 0.26
25 0.27
26 0.27
27 0.24
28 0.22
29 0.18
30 0.18
31 0.16
32 0.14
33 0.09
34 0.07
35 0.07
36 0.08
37 0.09
38 0.13
39 0.16
40 0.19
41 0.21
42 0.24
43 0.29
44 0.3
45 0.32
46 0.28
47 0.3
48 0.28
49 0.26
50 0.24
51 0.21
52 0.24
53 0.22
54 0.21
55 0.16
56 0.15
57 0.15
58 0.18
59 0.19
60 0.19
61 0.21
62 0.23
63 0.28
64 0.29
65 0.32
66 0.29
67 0.28
68 0.24
69 0.23
70 0.22
71 0.21
72 0.21
73 0.25
74 0.24
75 0.24
76 0.24
77 0.25
78 0.24
79 0.22
80 0.21
81 0.15
82 0.15
83 0.15
84 0.14
85 0.1
86 0.11
87 0.13
88 0.13
89 0.14
90 0.14
91 0.18
92 0.23
93 0.25
94 0.25
95 0.23
96 0.23
97 0.22
98 0.25
99 0.21
100 0.19
101 0.16
102 0.17
103 0.18
104 0.16
105 0.15
106 0.14
107 0.14
108 0.12
109 0.14
110 0.15
111 0.16
112 0.19
113 0.23
114 0.21
115 0.24
116 0.28
117 0.34
118 0.38
119 0.38
120 0.41
121 0.39
122 0.41
123 0.41
124 0.36
125 0.3
126 0.22
127 0.2
128 0.14
129 0.13
130 0.11
131 0.11
132 0.1
133 0.09
134 0.1
135 0.09
136 0.09
137 0.08
138 0.07
139 0.06
140 0.06
141 0.12
142 0.16
143 0.23
144 0.31
145 0.37
146 0.41
147 0.43
148 0.48
149 0.48
150 0.52
151 0.54
152 0.54
153 0.57
154 0.63
155 0.66
156 0.69
157 0.69
158 0.68
159 0.61
160 0.57
161 0.56
162 0.56
163 0.54
164 0.52
165 0.53
166 0.56
167 0.65
168 0.72
169 0.73
170 0.76
171 0.81
172 0.86
173 0.92
174 0.91
175 0.91
176 0.88