Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094DH54

Protein Details
Accession A0A094DH54    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
301-320HRLLNDKWVMKKRRRCHYYLHydrophilic
NLS Segment(s)
PositionSequence
190-231PPKRSLRGRGIGRPPASPPAKTEKTRSPPAKVKETRRPPVKI
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
Amino Acid Sequences MLSMLAGVAPYRHGPKAGGSGRQRQKQRELLDVVDVGKRGGGALMFAAKHWPKLNPSPGFSPPGSAAHLKNEAECQSQAEPGTNILEPSINHQDQHSSALHNAVLDIRPPLEGTKTNNEHTLGNMECIFIVHPGGRVATTYPGGHVATVHPGERVGIVHTGGELEYVSDARLAELLRQGRVKLAFSTPTPPKRSLRGRGIGRPPASPPAKTEKTRSPPAKVKETRRPPVKIKNATTSTGYATRSRTSTATNLSASTPRAQAKATMPTGFESATAPPQNAEPGGEDDNEEQDRGGGKQWKVHRLLNDKWVMKKRRRCHYYLIEWVGDYKPTWERAGNIASDLKEEYNAQCDKPRLLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.32
4 0.35
5 0.41
6 0.43
7 0.53
8 0.61
9 0.68
10 0.72
11 0.7
12 0.74
13 0.74
14 0.71
15 0.69
16 0.64
17 0.58
18 0.54
19 0.48
20 0.41
21 0.34
22 0.3
23 0.21
24 0.17
25 0.15
26 0.11
27 0.1
28 0.08
29 0.06
30 0.07
31 0.11
32 0.1
33 0.11
34 0.18
35 0.18
36 0.22
37 0.24
38 0.27
39 0.3
40 0.39
41 0.48
42 0.46
43 0.49
44 0.51
45 0.52
46 0.53
47 0.47
48 0.41
49 0.33
50 0.3
51 0.29
52 0.27
53 0.25
54 0.25
55 0.3
56 0.27
57 0.26
58 0.28
59 0.27
60 0.27
61 0.26
62 0.24
63 0.2
64 0.22
65 0.21
66 0.19
67 0.17
68 0.16
69 0.17
70 0.14
71 0.13
72 0.11
73 0.12
74 0.1
75 0.16
76 0.24
77 0.22
78 0.22
79 0.22
80 0.25
81 0.24
82 0.28
83 0.23
84 0.16
85 0.16
86 0.18
87 0.17
88 0.15
89 0.14
90 0.12
91 0.11
92 0.1
93 0.1
94 0.09
95 0.09
96 0.09
97 0.1
98 0.11
99 0.13
100 0.18
101 0.26
102 0.3
103 0.31
104 0.33
105 0.34
106 0.31
107 0.29
108 0.28
109 0.19
110 0.17
111 0.16
112 0.13
113 0.12
114 0.12
115 0.11
116 0.07
117 0.07
118 0.06
119 0.06
120 0.07
121 0.07
122 0.07
123 0.07
124 0.08
125 0.09
126 0.1
127 0.09
128 0.09
129 0.11
130 0.11
131 0.1
132 0.1
133 0.09
134 0.11
135 0.12
136 0.12
137 0.1
138 0.1
139 0.1
140 0.1
141 0.1
142 0.07
143 0.07
144 0.07
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.04
151 0.03
152 0.03
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.05
159 0.05
160 0.06
161 0.1
162 0.11
163 0.12
164 0.13
165 0.13
166 0.14
167 0.15
168 0.15
169 0.13
170 0.13
171 0.13
172 0.14
173 0.2
174 0.24
175 0.3
176 0.33
177 0.35
178 0.36
179 0.42
180 0.49
181 0.5
182 0.52
183 0.54
184 0.55
185 0.59
186 0.64
187 0.63
188 0.56
189 0.49
190 0.43
191 0.43
192 0.4
193 0.32
194 0.29
195 0.31
196 0.36
197 0.37
198 0.41
199 0.42
200 0.47
201 0.56
202 0.57
203 0.55
204 0.57
205 0.6
206 0.66
207 0.64
208 0.66
209 0.67
210 0.73
211 0.74
212 0.74
213 0.75
214 0.72
215 0.75
216 0.76
217 0.75
218 0.7
219 0.69
220 0.65
221 0.61
222 0.55
223 0.46
224 0.39
225 0.34
226 0.32
227 0.25
228 0.25
229 0.25
230 0.23
231 0.24
232 0.22
233 0.21
234 0.23
235 0.24
236 0.25
237 0.23
238 0.23
239 0.23
240 0.24
241 0.23
242 0.22
243 0.21
244 0.2
245 0.21
246 0.2
247 0.23
248 0.24
249 0.3
250 0.3
251 0.28
252 0.27
253 0.27
254 0.27
255 0.23
256 0.2
257 0.13
258 0.12
259 0.17
260 0.17
261 0.16
262 0.15
263 0.16
264 0.17
265 0.16
266 0.15
267 0.11
268 0.14
269 0.16
270 0.16
271 0.16
272 0.16
273 0.2
274 0.19
275 0.17
276 0.14
277 0.13
278 0.14
279 0.14
280 0.19
281 0.22
282 0.23
283 0.3
284 0.37
285 0.44
286 0.48
287 0.51
288 0.54
289 0.54
290 0.58
291 0.61
292 0.63
293 0.58
294 0.62
295 0.68
296 0.68
297 0.7
298 0.75
299 0.75
300 0.78
301 0.81
302 0.77
303 0.77
304 0.78
305 0.78
306 0.78
307 0.74
308 0.65
309 0.58
310 0.55
311 0.46
312 0.37
313 0.28
314 0.21
315 0.2
316 0.22
317 0.25
318 0.24
319 0.25
320 0.3
321 0.33
322 0.3
323 0.29
324 0.3
325 0.27
326 0.27
327 0.27
328 0.22
329 0.19
330 0.21
331 0.19
332 0.23
333 0.25
334 0.25
335 0.3
336 0.33
337 0.35