Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094CX74

Protein Details
Accession A0A094CX74   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
234-255SLGPRRCAPRRLQHHEQFQCRAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, nucl 4.5, cyto_nucl 4, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017941  Rieske_2Fe-2S  
IPR036922  Rieske_2Fe-2S_sf  
Gene Ontology GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00355  Rieske  
PROSITE View protein in PROSITE  
PS51296  RIESKE  
Amino Acid Sequences MNPSRAASRTDAQWLFVGHASAFLDVESDDGANLSQSRACNAGYKPGCKAFYTSNEDGEKDGSANHKGLAEADLDEVLDLKSQVLVFRYRGKFHAVDHQCPHSSFPLSRGTLFDIEDFGVVLSAGLTCPKHEWSFDLFTGTGDRGNYRLKIWEVQLRGGVDGSDQEVWTAATAATKSLDCLGIRRALPVFDPNVCRQRPRHTRRSLLVHPAHPTNSDQPPPPLDRGPAAFDDASLGPRRCAPRRLQHHEQFQCRASRAAADPDPAELGYLGAVFLLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.26
4 0.24
5 0.15
6 0.16
7 0.15
8 0.13
9 0.13
10 0.1
11 0.09
12 0.08
13 0.08
14 0.07
15 0.06
16 0.05
17 0.05
18 0.06
19 0.06
20 0.07
21 0.07
22 0.1
23 0.1
24 0.12
25 0.14
26 0.14
27 0.19
28 0.19
29 0.29
30 0.31
31 0.33
32 0.36
33 0.41
34 0.42
35 0.37
36 0.4
37 0.35
38 0.39
39 0.45
40 0.42
41 0.42
42 0.42
43 0.41
44 0.39
45 0.34
46 0.26
47 0.17
48 0.17
49 0.14
50 0.15
51 0.15
52 0.15
53 0.15
54 0.15
55 0.15
56 0.14
57 0.12
58 0.1
59 0.1
60 0.09
61 0.08
62 0.07
63 0.07
64 0.06
65 0.06
66 0.05
67 0.04
68 0.06
69 0.06
70 0.07
71 0.09
72 0.11
73 0.13
74 0.22
75 0.25
76 0.26
77 0.27
78 0.31
79 0.3
80 0.3
81 0.38
82 0.34
83 0.37
84 0.38
85 0.41
86 0.38
87 0.37
88 0.37
89 0.29
90 0.27
91 0.21
92 0.21
93 0.24
94 0.24
95 0.24
96 0.23
97 0.23
98 0.22
99 0.22
100 0.19
101 0.12
102 0.11
103 0.1
104 0.09
105 0.06
106 0.05
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.04
113 0.04
114 0.05
115 0.06
116 0.08
117 0.09
118 0.09
119 0.12
120 0.15
121 0.18
122 0.18
123 0.18
124 0.16
125 0.16
126 0.17
127 0.14
128 0.11
129 0.08
130 0.08
131 0.09
132 0.11
133 0.11
134 0.11
135 0.14
136 0.14
137 0.16
138 0.18
139 0.21
140 0.2
141 0.2
142 0.22
143 0.2
144 0.19
145 0.16
146 0.14
147 0.09
148 0.08
149 0.08
150 0.06
151 0.06
152 0.05
153 0.06
154 0.06
155 0.06
156 0.06
157 0.04
158 0.05
159 0.05
160 0.06
161 0.06
162 0.06
163 0.07
164 0.07
165 0.1
166 0.09
167 0.1
168 0.12
169 0.16
170 0.16
171 0.17
172 0.17
173 0.15
174 0.17
175 0.18
176 0.18
177 0.17
178 0.21
179 0.24
180 0.32
181 0.32
182 0.35
183 0.36
184 0.44
185 0.52
186 0.57
187 0.63
188 0.63
189 0.7
190 0.73
191 0.78
192 0.73
193 0.72
194 0.69
195 0.62
196 0.58
197 0.53
198 0.47
199 0.39
200 0.37
201 0.33
202 0.33
203 0.32
204 0.31
205 0.31
206 0.35
207 0.37
208 0.38
209 0.34
210 0.3
211 0.3
212 0.3
213 0.3
214 0.27
215 0.26
216 0.22
217 0.2
218 0.21
219 0.18
220 0.19
221 0.22
222 0.21
223 0.18
224 0.24
225 0.31
226 0.34
227 0.4
228 0.46
229 0.51
230 0.61
231 0.7
232 0.74
233 0.76
234 0.82
235 0.84
236 0.83
237 0.78
238 0.72
239 0.69
240 0.6
241 0.54
242 0.44
243 0.4
244 0.36
245 0.38
246 0.35
247 0.33
248 0.31
249 0.3
250 0.3
251 0.25
252 0.22
253 0.14
254 0.12
255 0.09
256 0.08
257 0.06