Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179TYE5

Protein Details
Accession A0A179TYE5   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-41VLRTIKAREHCHRLKKEKKKMFKQEETDCKKMBasic
NLS Segment(s)
PositionSequence
24-28KKEKK
77-87KEKKKKKKNEK
Subcellular Location(s) mito 20.5, cyto_mito 11, nucl 6
Family & Domain DBs
Amino Acid Sequences MSSLFKYSVVLRTIKAREHCHRLKKEKKKMFKQEETDCKKMWDFKAQINLAEREQQKLFSEKAVKRDFEMIITSDEKEKKKKKKNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.43
4 0.48
5 0.56
6 0.63
7 0.65
8 0.72
9 0.76
10 0.81
11 0.83
12 0.87
13 0.87
14 0.89
15 0.9
16 0.91
17 0.9
18 0.88
19 0.85
20 0.84
21 0.85
22 0.82
23 0.74
24 0.64
25 0.55
26 0.48
27 0.45
28 0.37
29 0.35
30 0.29
31 0.28
32 0.36
33 0.35
34 0.36
35 0.34
36 0.33
37 0.26
38 0.3
39 0.28
40 0.23
41 0.23
42 0.22
43 0.21
44 0.23
45 0.22
46 0.21
47 0.29
48 0.29
49 0.38
50 0.41
51 0.4
52 0.39
53 0.43
54 0.38
55 0.31
56 0.3
57 0.22
58 0.21
59 0.22
60 0.21
61 0.23
62 0.29
63 0.32
64 0.4
65 0.48
66 0.56
67 0.65