Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094DLU9

Protein Details
Accession A0A094DLU9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-63NATTPKPAKSLKSKKRKEQPAYASSSAHydrophilic
NLS Segment(s)
PositionSequence
42-54KPAKSLKSKKRKE
Subcellular Location(s) mito 22.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR002717  HAT_MYST-type  
IPR036388  WH-like_DNA-bd_sf  
IPR040706  Zf-MYST  
Gene Ontology GO:0005694  C:chromosome  
GO:0004402  F:histone acetyltransferase activity  
GO:0016573  P:histone acetylation  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF01853  MOZ_SAS  
PF17772  zf-MYST  
PROSITE View protein in PROSITE  
PS51726  MYST_HAT  
Amino Acid Sequences MAPMKRKRGAASGAPRTTRSTTAANASTTTGTTGAQNATTPKPAKSLKSKKRKEQPAYASSSASAPSPLKPESAPPVAGRARKSRAMPTATARRAVSLTPSLSSSTSKPSAAPAPTLERNVDNVVLGDILFRAWYPSRHVKEIVGREVVEEKEMLERLYVCKHCFKYSKELMGWVGHGKACERRRGGAAPMVPGRKIYSHGNSGWSVWEVDGEVDSLYCQNLCLFAKLFLDNKSVFFDVTGFIYLLLVHTNPTTGEEQVIGFFSKEKMSWDNNNLACILVFPPWQHKGLGSLLIAVSYEISRREKIIGGPEKPISDLGKMSYIKYWSGEVARYLLDVGDMEKKKTKVVSLDDISAGTWICVEDCLTALKHMNIAVAAPRGKGDVQRVKIDKQQLREWMAASKTSLGPIIDPDGFEAGYGYRESSADEEAGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.6
4 0.57
5 0.5
6 0.44
7 0.37
8 0.34
9 0.38
10 0.4
11 0.35
12 0.33
13 0.32
14 0.29
15 0.25
16 0.22
17 0.16
18 0.13
19 0.13
20 0.14
21 0.14
22 0.13
23 0.15
24 0.18
25 0.2
26 0.27
27 0.28
28 0.27
29 0.33
30 0.37
31 0.43
32 0.5
33 0.59
34 0.62
35 0.71
36 0.8
37 0.83
38 0.89
39 0.92
40 0.9
41 0.89
42 0.88
43 0.86
44 0.84
45 0.76
46 0.66
47 0.56
48 0.48
49 0.38
50 0.28
51 0.22
52 0.15
53 0.16
54 0.19
55 0.19
56 0.2
57 0.2
58 0.24
59 0.27
60 0.3
61 0.3
62 0.26
63 0.33
64 0.36
65 0.4
66 0.4
67 0.41
68 0.42
69 0.46
70 0.49
71 0.48
72 0.51
73 0.51
74 0.51
75 0.51
76 0.57
77 0.53
78 0.54
79 0.47
80 0.41
81 0.37
82 0.34
83 0.3
84 0.24
85 0.23
86 0.19
87 0.2
88 0.2
89 0.2
90 0.21
91 0.18
92 0.2
93 0.21
94 0.21
95 0.2
96 0.22
97 0.27
98 0.26
99 0.26
100 0.23
101 0.27
102 0.29
103 0.31
104 0.29
105 0.24
106 0.25
107 0.25
108 0.22
109 0.16
110 0.13
111 0.11
112 0.1
113 0.09
114 0.07
115 0.05
116 0.05
117 0.04
118 0.04
119 0.06
120 0.08
121 0.09
122 0.16
123 0.26
124 0.3
125 0.33
126 0.34
127 0.35
128 0.41
129 0.46
130 0.43
131 0.35
132 0.32
133 0.29
134 0.31
135 0.28
136 0.21
137 0.15
138 0.11
139 0.12
140 0.12
141 0.11
142 0.09
143 0.09
144 0.1
145 0.17
146 0.19
147 0.19
148 0.26
149 0.28
150 0.33
151 0.38
152 0.4
153 0.43
154 0.46
155 0.5
156 0.44
157 0.44
158 0.4
159 0.35
160 0.33
161 0.24
162 0.2
163 0.14
164 0.13
165 0.13
166 0.19
167 0.21
168 0.26
169 0.26
170 0.27
171 0.29
172 0.31
173 0.32
174 0.29
175 0.27
176 0.25
177 0.28
178 0.27
179 0.24
180 0.22
181 0.21
182 0.17
183 0.18
184 0.18
185 0.17
186 0.21
187 0.21
188 0.24
189 0.23
190 0.23
191 0.21
192 0.17
193 0.14
194 0.1
195 0.09
196 0.06
197 0.06
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.03
208 0.06
209 0.06
210 0.07
211 0.08
212 0.09
213 0.11
214 0.12
215 0.14
216 0.13
217 0.16
218 0.16
219 0.16
220 0.17
221 0.16
222 0.14
223 0.12
224 0.11
225 0.08
226 0.09
227 0.08
228 0.06
229 0.06
230 0.06
231 0.05
232 0.05
233 0.05
234 0.04
235 0.04
236 0.04
237 0.05
238 0.05
239 0.07
240 0.08
241 0.08
242 0.08
243 0.08
244 0.09
245 0.09
246 0.1
247 0.07
248 0.06
249 0.07
250 0.08
251 0.08
252 0.08
253 0.1
254 0.14
255 0.18
256 0.23
257 0.26
258 0.33
259 0.33
260 0.33
261 0.31
262 0.27
263 0.22
264 0.18
265 0.15
266 0.09
267 0.09
268 0.09
269 0.14
270 0.16
271 0.18
272 0.17
273 0.16
274 0.18
275 0.19
276 0.21
277 0.15
278 0.14
279 0.13
280 0.12
281 0.12
282 0.09
283 0.08
284 0.05
285 0.06
286 0.08
287 0.11
288 0.12
289 0.13
290 0.15
291 0.16
292 0.19
293 0.28
294 0.33
295 0.32
296 0.36
297 0.36
298 0.35
299 0.34
300 0.34
301 0.25
302 0.19
303 0.18
304 0.15
305 0.2
306 0.21
307 0.21
308 0.22
309 0.22
310 0.21
311 0.21
312 0.21
313 0.17
314 0.18
315 0.19
316 0.16
317 0.16
318 0.15
319 0.14
320 0.13
321 0.11
322 0.09
323 0.07
324 0.08
325 0.16
326 0.17
327 0.19
328 0.25
329 0.26
330 0.29
331 0.3
332 0.32
333 0.3
334 0.36
335 0.42
336 0.39
337 0.41
338 0.38
339 0.36
340 0.33
341 0.26
342 0.2
343 0.11
344 0.08
345 0.06
346 0.05
347 0.06
348 0.06
349 0.06
350 0.07
351 0.09
352 0.09
353 0.12
354 0.14
355 0.14
356 0.15
357 0.15
358 0.15
359 0.13
360 0.13
361 0.14
362 0.17
363 0.18
364 0.17
365 0.17
366 0.18
367 0.19
368 0.22
369 0.29
370 0.33
371 0.37
372 0.46
373 0.49
374 0.51
375 0.56
376 0.63
377 0.58
378 0.55
379 0.58
380 0.56
381 0.57
382 0.55
383 0.5
384 0.46
385 0.43
386 0.39
387 0.33
388 0.29
389 0.25
390 0.24
391 0.25
392 0.19
393 0.18
394 0.18
395 0.22
396 0.18
397 0.18
398 0.18
399 0.17
400 0.17
401 0.16
402 0.14
403 0.1
404 0.11
405 0.11
406 0.11
407 0.1
408 0.1
409 0.12
410 0.14
411 0.16