Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094DP33

Protein Details
Accession A0A094DP33    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-89GKSRAPSRRHCVSRPRPAPRABasic
NLS Segment(s)
PositionSequence
72-78RAPSRRH
81-92SRPRPAPRAGQK
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSFPAFRGRSTRRQTSNVKPSVDFAKLTPFASSSGSPDTTASNTAHHSEQEINVLITGFGPNTPSTPPGKSRAPSRRHCVSRPRPAPRAGQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.76
4 0.73
5 0.67
6 0.58
7 0.55
8 0.52
9 0.46
10 0.36
11 0.26
12 0.27
13 0.25
14 0.25
15 0.23
16 0.19
17 0.18
18 0.19
19 0.19
20 0.13
21 0.15
22 0.15
23 0.15
24 0.15
25 0.15
26 0.13
27 0.15
28 0.13
29 0.11
30 0.12
31 0.13
32 0.13
33 0.12
34 0.13
35 0.12
36 0.12
37 0.12
38 0.11
39 0.1
40 0.09
41 0.09
42 0.07
43 0.07
44 0.06
45 0.05
46 0.04
47 0.06
48 0.06
49 0.07
50 0.08
51 0.11
52 0.13
53 0.17
54 0.2
55 0.24
56 0.3
57 0.32
58 0.42
59 0.49
60 0.55
61 0.6
62 0.65
63 0.7
64 0.71
65 0.75
66 0.76
67 0.76
68 0.79
69 0.81
70 0.82
71 0.78
72 0.77