Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094CQ85

Protein Details
Accession A0A094CQ85    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-39LPMLGYQKYRKHKAKKAIKKELAKQPEPHydrophilic
NLS Segment(s)
PositionSequence
21-32RKHKAKKAIKKE
Subcellular Location(s) extr 13, mito 9, nucl 3
Family & Domain DBs
Amino Acid Sequences MAAVILMAIVVLPMLGYQKYRKHKAKKAIKKELAKQPEPLQGGYQAVREQSGDHPPSYDDTVGSHPSPPYSPNRPPGYIQRPSSNRELPAGHLPNSYLSPTAVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.08
4 0.13
5 0.22
6 0.31
7 0.41
8 0.51
9 0.6
10 0.68
11 0.77
12 0.83
13 0.86
14 0.88
15 0.89
16 0.88
17 0.86
18 0.86
19 0.85
20 0.83
21 0.74
22 0.67
23 0.6
24 0.58
25 0.51
26 0.43
27 0.34
28 0.26
29 0.26
30 0.22
31 0.18
32 0.13
33 0.11
34 0.11
35 0.1
36 0.1
37 0.1
38 0.16
39 0.17
40 0.16
41 0.16
42 0.16
43 0.18
44 0.18
45 0.16
46 0.09
47 0.1
48 0.12
49 0.14
50 0.15
51 0.14
52 0.13
53 0.14
54 0.15
55 0.16
56 0.2
57 0.25
58 0.3
59 0.37
60 0.42
61 0.43
62 0.46
63 0.53
64 0.55
65 0.55
66 0.53
67 0.54
68 0.53
69 0.55
70 0.59
71 0.54
72 0.47
73 0.43
74 0.4
75 0.35
76 0.42
77 0.41
78 0.36
79 0.32
80 0.31
81 0.3
82 0.3
83 0.28
84 0.18
85 0.15