Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094CFH5

Protein Details
Accession A0A094CFH5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-76LHQHNSNKMRAKWRKKRTRRLKRKRRKTRARSKBasic
NLS Segment(s)
PositionSequence
51-76KMRAKWRKKRTRRLKRKRRKTRARSK
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MHCNITIPAYSYQEALAVGTVAVRDTQLTTSLLTTTSSLLHHQLHQHNSNKMRAKWRKKRTRRLKRKRRKTRARSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.1
4 0.06
5 0.05
6 0.05
7 0.05
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.06
14 0.07
15 0.08
16 0.08
17 0.08
18 0.09
19 0.09
20 0.08
21 0.08
22 0.07
23 0.08
24 0.08
25 0.08
26 0.1
27 0.11
28 0.12
29 0.17
30 0.22
31 0.27
32 0.33
33 0.37
34 0.41
35 0.43
36 0.49
37 0.51
38 0.5
39 0.56
40 0.6
41 0.66
42 0.7
43 0.78
44 0.82
45 0.86
46 0.93
47 0.94
48 0.95
49 0.95
50 0.96
51 0.96
52 0.97
53 0.97
54 0.98
55 0.97
56 0.97