Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094DR73

Protein Details
Accession A0A094DR73   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-25STEQTIVKKRGRPRKNPLPETASPHydrophilic
NLS Segment(s)
PositionSequence
9-18KKRGRPRKNP
48-56PAKPRTRKA
141-180KPVSHPRTPSKTSTPKPPAKTAAKTPPPKPAPPTKPPAPK
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 7, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTEQTIVKKRGRPRKNPLPETASPSSPAPAKTTTARKTVAKTSPVEPAKPRTRKAKTPALETPSPEAAMPTIPSQPTAAASANSPIPESIELSNQATSAAPSLSHPASPTPQHRPSAILTAVRELSTKASPAPKPAASTKPVSHPRTPSKTSTPKPPAKTAAKTPPPKPAPPTKPPAPKIPLSALNATIVDNITKPAGARPSAGGQQQLPKGYKPVARKVTMVIVALPIAIVTSYVLWQRLVLGEEQKVLVKPAPVVDVDAKEKGPESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.87
4 0.87
5 0.86
6 0.84
7 0.78
8 0.76
9 0.69
10 0.59
11 0.51
12 0.44
13 0.39
14 0.33
15 0.3
16 0.26
17 0.24
18 0.26
19 0.3
20 0.39
21 0.41
22 0.43
23 0.46
24 0.46
25 0.49
26 0.54
27 0.54
28 0.5
29 0.48
30 0.45
31 0.5
32 0.5
33 0.49
34 0.45
35 0.48
36 0.53
37 0.57
38 0.6
39 0.61
40 0.65
41 0.69
42 0.72
43 0.73
44 0.67
45 0.68
46 0.7
47 0.67
48 0.62
49 0.56
50 0.52
51 0.43
52 0.39
53 0.31
54 0.24
55 0.17
56 0.15
57 0.14
58 0.11
59 0.12
60 0.12
61 0.13
62 0.13
63 0.13
64 0.13
65 0.14
66 0.13
67 0.1
68 0.11
69 0.12
70 0.13
71 0.12
72 0.12
73 0.09
74 0.09
75 0.09
76 0.11
77 0.1
78 0.11
79 0.12
80 0.13
81 0.13
82 0.12
83 0.12
84 0.1
85 0.09
86 0.08
87 0.07
88 0.06
89 0.06
90 0.1
91 0.1
92 0.1
93 0.1
94 0.11
95 0.14
96 0.18
97 0.22
98 0.27
99 0.31
100 0.32
101 0.32
102 0.33
103 0.32
104 0.33
105 0.29
106 0.23
107 0.19
108 0.19
109 0.19
110 0.17
111 0.16
112 0.11
113 0.12
114 0.1
115 0.1
116 0.1
117 0.15
118 0.16
119 0.19
120 0.22
121 0.2
122 0.22
123 0.26
124 0.28
125 0.25
126 0.28
127 0.26
128 0.31
129 0.39
130 0.42
131 0.42
132 0.45
133 0.5
134 0.54
135 0.56
136 0.52
137 0.52
138 0.57
139 0.56
140 0.6
141 0.61
142 0.61
143 0.61
144 0.62
145 0.61
146 0.58
147 0.59
148 0.55
149 0.56
150 0.58
151 0.6
152 0.58
153 0.6
154 0.58
155 0.58
156 0.56
157 0.56
158 0.55
159 0.55
160 0.61
161 0.59
162 0.64
163 0.64
164 0.67
165 0.61
166 0.56
167 0.53
168 0.5
169 0.47
170 0.41
171 0.4
172 0.32
173 0.28
174 0.26
175 0.22
176 0.18
177 0.13
178 0.1
179 0.08
180 0.08
181 0.07
182 0.07
183 0.07
184 0.1
185 0.13
186 0.14
187 0.15
188 0.16
189 0.2
190 0.23
191 0.24
192 0.23
193 0.21
194 0.27
195 0.29
196 0.32
197 0.3
198 0.27
199 0.29
200 0.32
201 0.36
202 0.36
203 0.43
204 0.46
205 0.46
206 0.46
207 0.46
208 0.46
209 0.43
210 0.37
211 0.28
212 0.21
213 0.18
214 0.17
215 0.14
216 0.08
217 0.05
218 0.04
219 0.04
220 0.04
221 0.04
222 0.06
223 0.08
224 0.1
225 0.1
226 0.1
227 0.11
228 0.12
229 0.13
230 0.15
231 0.17
232 0.18
233 0.19
234 0.2
235 0.21
236 0.2
237 0.21
238 0.2
239 0.18
240 0.18
241 0.19
242 0.2
243 0.18
244 0.22
245 0.24
246 0.26
247 0.28
248 0.29
249 0.27
250 0.26