Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094FY81

Protein Details
Accession A0A094FY81    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTPKKSRKRHNRPSRPVPVPVSKBasic
NLS Segment(s)
PositionSequence
4-15KKSRKRHNRPSR
Subcellular Location(s) mito 19, nucl 2, golg 2, cyto 1, plas 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTPKKSRKRHNRPSRPVPVPVSKEIITCRRTITPQSQPQPQPQSQPQAQSKPQSPGHVEPKSKNVNPVAKSQRKVITKAGTSASNWMVRVLVPVLIEVPKISMAILFLYALWINWVLASSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.89
3 0.84
4 0.8
5 0.78
6 0.72
7 0.64
8 0.59
9 0.49
10 0.45
11 0.43
12 0.44
13 0.36
14 0.32
15 0.32
16 0.3
17 0.32
18 0.36
19 0.38
20 0.41
21 0.48
22 0.52
23 0.58
24 0.57
25 0.62
26 0.65
27 0.58
28 0.55
29 0.5
30 0.53
31 0.46
32 0.51
33 0.48
34 0.47
35 0.49
36 0.47
37 0.45
38 0.44
39 0.44
40 0.39
41 0.38
42 0.38
43 0.43
44 0.44
45 0.43
46 0.38
47 0.43
48 0.46
49 0.43
50 0.41
51 0.37
52 0.38
53 0.38
54 0.45
55 0.48
56 0.48
57 0.49
58 0.5
59 0.51
60 0.48
61 0.49
62 0.47
63 0.43
64 0.38
65 0.39
66 0.37
67 0.31
68 0.29
69 0.29
70 0.26
71 0.21
72 0.2
73 0.17
74 0.15
75 0.14
76 0.15
77 0.12
78 0.1
79 0.08
80 0.08
81 0.09
82 0.1
83 0.1
84 0.08
85 0.08
86 0.07
87 0.07
88 0.07
89 0.06
90 0.06
91 0.07
92 0.07
93 0.06
94 0.06
95 0.08
96 0.08
97 0.07
98 0.08
99 0.08
100 0.08
101 0.08