Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094G355

Protein Details
Accession A0A094G355    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSGLETRRPKRVRRAPSHLLRNDGHydrophilic
NLS Segment(s)
PositionSequence
8-16RPKRVRRAP
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences MSGLETRRPKRVRRAPSHLLRNDGGKRVAKTVIHNTRSYLKQHDLQGQHKGKPRTLKRIPTVSVHSLQGGSGRMAGINSNDDGGPHLTVSELEQVQQCCVKSSAALQQYVEQGEQFRSTIQVLQEALHANISQFAALKLEAHRSSGELEAVKKENERVTADLNQMKAGNTSRINGIMKTVGGFFVRSRNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.86
4 0.89
5 0.82
6 0.77
7 0.68
8 0.66
9 0.61
10 0.55
11 0.51
12 0.45
13 0.43
14 0.4
15 0.43
16 0.37
17 0.39
18 0.45
19 0.49
20 0.48
21 0.47
22 0.47
23 0.49
24 0.5
25 0.47
26 0.43
27 0.37
28 0.39
29 0.43
30 0.48
31 0.47
32 0.48
33 0.54
34 0.53
35 0.54
36 0.56
37 0.55
38 0.51
39 0.55
40 0.58
41 0.59
42 0.62
43 0.65
44 0.65
45 0.69
46 0.67
47 0.61
48 0.6
49 0.54
50 0.48
51 0.39
52 0.33
53 0.25
54 0.23
55 0.2
56 0.15
57 0.1
58 0.08
59 0.08
60 0.07
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.08
71 0.08
72 0.06
73 0.06
74 0.05
75 0.06
76 0.06
77 0.08
78 0.07
79 0.08
80 0.1
81 0.11
82 0.11
83 0.13
84 0.12
85 0.11
86 0.11
87 0.11
88 0.09
89 0.11
90 0.17
91 0.17
92 0.18
93 0.17
94 0.18
95 0.2
96 0.2
97 0.18
98 0.12
99 0.1
100 0.1
101 0.11
102 0.09
103 0.08
104 0.08
105 0.09
106 0.11
107 0.1
108 0.11
109 0.11
110 0.11
111 0.13
112 0.13
113 0.13
114 0.11
115 0.11
116 0.08
117 0.1
118 0.09
119 0.08
120 0.07
121 0.07
122 0.07
123 0.07
124 0.09
125 0.08
126 0.15
127 0.15
128 0.16
129 0.17
130 0.16
131 0.18
132 0.18
133 0.19
134 0.14
135 0.16
136 0.18
137 0.2
138 0.21
139 0.2
140 0.23
141 0.23
142 0.25
143 0.27
144 0.25
145 0.28
146 0.31
147 0.36
148 0.36
149 0.33
150 0.31
151 0.29
152 0.27
153 0.26
154 0.24
155 0.24
156 0.22
157 0.23
158 0.23
159 0.28
160 0.29
161 0.26
162 0.26
163 0.22
164 0.2
165 0.2
166 0.18
167 0.15
168 0.14
169 0.16
170 0.14