Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094C184

Protein Details
Accession A0A094C184   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
93-116LEIVTPPKEKRTRNTRPDLCPVSRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MKHRASVILLYKIHRRGARPLVVRGRAVGADYNKKPAQEAAGQGAAKEVAEAAAAKKTAEGSSLRPSSDQLHWRKRTVVGKRHIRMQSNEPNLEIVTPPKEKRTRNTRPDLCPVSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.43
4 0.49
5 0.55
6 0.53
7 0.57
8 0.6
9 0.6
10 0.57
11 0.49
12 0.42
13 0.34
14 0.3
15 0.26
16 0.22
17 0.27
18 0.27
19 0.33
20 0.32
21 0.32
22 0.32
23 0.28
24 0.27
25 0.22
26 0.23
27 0.2
28 0.23
29 0.22
30 0.21
31 0.21
32 0.17
33 0.13
34 0.11
35 0.07
36 0.03
37 0.03
38 0.04
39 0.04
40 0.05
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.08
47 0.09
48 0.1
49 0.17
50 0.19
51 0.19
52 0.18
53 0.2
54 0.21
55 0.25
56 0.31
57 0.32
58 0.42
59 0.45
60 0.47
61 0.48
62 0.51
63 0.54
64 0.56
65 0.56
66 0.56
67 0.63
68 0.64
69 0.7
70 0.69
71 0.65
72 0.6
73 0.6
74 0.6
75 0.57
76 0.56
77 0.48
78 0.43
79 0.38
80 0.35
81 0.27
82 0.2
83 0.18
84 0.22
85 0.24
86 0.32
87 0.39
88 0.44
89 0.53
90 0.6
91 0.66
92 0.71
93 0.8
94 0.8
95 0.79
96 0.84