Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094DSX6

Protein Details
Accession A0A094DSX6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-34AKTFLRPKSSKSRRKNRREVRTGGYHydrophilic
NLS Segment(s)
PositionSequence
15-28RPKSSKSRRKNRRE
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVEQHRDEAAKTFLRPKSSKSRRKNRREVRTGGYVPDRPLDVAVRLEVVVRQNVRTVVLEAHVALHLREDMVLEEPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.43
4 0.49
5 0.57
6 0.65
7 0.68
8 0.75
9 0.78
10 0.88
11 0.93
12 0.92
13 0.92
14 0.9
15 0.85
16 0.79
17 0.77
18 0.67
19 0.59
20 0.53
21 0.43
22 0.36
23 0.31
24 0.25
25 0.17
26 0.16
27 0.14
28 0.1
29 0.09
30 0.08
31 0.08
32 0.07
33 0.08
34 0.08
35 0.09
36 0.12
37 0.12
38 0.13
39 0.14
40 0.14
41 0.16
42 0.15
43 0.15
44 0.13
45 0.13
46 0.13
47 0.11
48 0.12
49 0.11
50 0.1
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.08
57 0.08