Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094D5N8

Protein Details
Accession A0A094D5N8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
152-186AAGQKMDKEARKRDKKEKEKALKREKAEKARKGASBasic
NLS Segment(s)
PositionSequence
159-187KEARKRDKKEKEKALKREKAEKARKGASA
Subcellular Location(s) mito 16.5, cyto_mito 11.666, mito_nucl 11.499, cyto_nucl 5.499, nucl 5
Family & Domain DBs
Amino Acid Sequences MSTTSFPPHHSKPSRPISSSLALHHLTTYLTAAATTPSLLPSATLQSTGPIAPTDAASNLLIQHLQRVEAGLKGEWLAPTLDLEESYGAAEDTTGGEGQKEGEADVEMGTDGWQDLDEYQREQSVEVGELGGESVVASEEPAVGLEVKASDAAGQKMDKEARKRDKKEKEKALKREKAEKARKGASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.67
3 0.66
4 0.61
5 0.61
6 0.56
7 0.49
8 0.44
9 0.37
10 0.34
11 0.3
12 0.24
13 0.18
14 0.16
15 0.14
16 0.09
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.08
29 0.11
30 0.11
31 0.11
32 0.11
33 0.11
34 0.13
35 0.12
36 0.11
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.07
43 0.09
44 0.09
45 0.09
46 0.08
47 0.08
48 0.09
49 0.08
50 0.1
51 0.09
52 0.09
53 0.09
54 0.1
55 0.1
56 0.11
57 0.12
58 0.09
59 0.09
60 0.09
61 0.1
62 0.08
63 0.08
64 0.07
65 0.06
66 0.06
67 0.07
68 0.06
69 0.05
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.04
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.04
95 0.04
96 0.04
97 0.04
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.07
104 0.08
105 0.09
106 0.09
107 0.11
108 0.11
109 0.11
110 0.12
111 0.1
112 0.1
113 0.09
114 0.08
115 0.07
116 0.06
117 0.06
118 0.05
119 0.04
120 0.03
121 0.02
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.04
129 0.04
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.06
136 0.05
137 0.07
138 0.09
139 0.11
140 0.13
141 0.13
142 0.13
143 0.19
144 0.25
145 0.29
146 0.34
147 0.44
148 0.52
149 0.63
150 0.71
151 0.76
152 0.81
153 0.86
154 0.89
155 0.9
156 0.9
157 0.9
158 0.93
159 0.93
160 0.9
161 0.87
162 0.86
163 0.85
164 0.85
165 0.85
166 0.82
167 0.8