Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094CYZ5

Protein Details
Accession A0A094CYZ5   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
282-309VKEVRYLVGKRSRRQRKGRLIRVGGQRKBasic
NLS Segment(s)
PositionSequence
290-309GKRSRRQRKGRLIRVGGQRK
Subcellular Location(s) mito 9, cyto_nucl 6, nucl 5.5, cyto 5.5, extr 2, golg 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001969  Aspartic_peptidase_AS  
IPR001995  Peptidase_A2_cat  
IPR021109  Peptidase_aspartic_dom_sf  
Gene Ontology GO:0004190  F:aspartic-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF13650  Asp_protease_2  
PROSITE View protein in PROSITE  
PS50175  ASP_PROT_RETROV  
PS00141  ASP_PROTEASE  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MDILFSGNGGGCGDPRCEACSVGGMGGGMGGGMGGFMSPFPIPGFGMPPFMPCGPGCTGDCQNPGVGGGGGGGGGGFPGSMPGGDGGFPGPMPGGMNFPGFSPPSGPGPTNFPGPEGQNFPGPYPQPTEWPGAGPGNFGGPSGGGRVTTTESPYISPMGATGQRINMMIDTGASMTIITSAAFNKHFRAIPVRTDKRLNISGVDGGLSATHQRFTMPLTFDFGNGQATVEGEAWICDSEVDVECLLGLPYLRANHMSLEWGSNGEPDSIMVQGNKIPINTEVKEVRYLVGKRSRRQRKGRLIRVGGQRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.17
4 0.17
5 0.18
6 0.17
7 0.18
8 0.18
9 0.16
10 0.15
11 0.12
12 0.11
13 0.1
14 0.09
15 0.04
16 0.03
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.04
25 0.04
26 0.05
27 0.06
28 0.07
29 0.08
30 0.09
31 0.13
32 0.12
33 0.16
34 0.15
35 0.17
36 0.19
37 0.19
38 0.2
39 0.16
40 0.2
41 0.18
42 0.21
43 0.21
44 0.23
45 0.26
46 0.28
47 0.3
48 0.27
49 0.25
50 0.21
51 0.21
52 0.16
53 0.13
54 0.08
55 0.07
56 0.06
57 0.05
58 0.05
59 0.04
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.03
67 0.03
68 0.03
69 0.04
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.07
82 0.08
83 0.1
84 0.1
85 0.1
86 0.12
87 0.12
88 0.12
89 0.11
90 0.12
91 0.14
92 0.16
93 0.16
94 0.14
95 0.2
96 0.21
97 0.23
98 0.21
99 0.19
100 0.2
101 0.21
102 0.23
103 0.21
104 0.2
105 0.2
106 0.21
107 0.2
108 0.23
109 0.21
110 0.2
111 0.21
112 0.21
113 0.2
114 0.22
115 0.25
116 0.21
117 0.21
118 0.21
119 0.18
120 0.17
121 0.15
122 0.12
123 0.1
124 0.1
125 0.09
126 0.07
127 0.05
128 0.05
129 0.06
130 0.06
131 0.05
132 0.05
133 0.06
134 0.08
135 0.09
136 0.1
137 0.09
138 0.1
139 0.1
140 0.11
141 0.1
142 0.08
143 0.07
144 0.06
145 0.07
146 0.08
147 0.09
148 0.09
149 0.09
150 0.1
151 0.1
152 0.1
153 0.08
154 0.07
155 0.06
156 0.05
157 0.05
158 0.04
159 0.04
160 0.04
161 0.03
162 0.03
163 0.03
164 0.04
165 0.03
166 0.04
167 0.04
168 0.06
169 0.09
170 0.1
171 0.11
172 0.14
173 0.14
174 0.15
175 0.22
176 0.22
177 0.28
178 0.38
179 0.41
180 0.42
181 0.45
182 0.45
183 0.44
184 0.45
185 0.38
186 0.29
187 0.26
188 0.23
189 0.2
190 0.18
191 0.12
192 0.09
193 0.08
194 0.07
195 0.08
196 0.07
197 0.08
198 0.07
199 0.08
200 0.08
201 0.11
202 0.16
203 0.16
204 0.16
205 0.2
206 0.2
207 0.2
208 0.21
209 0.19
210 0.15
211 0.12
212 0.12
213 0.08
214 0.08
215 0.09
216 0.08
217 0.08
218 0.07
219 0.07
220 0.07
221 0.07
222 0.07
223 0.05
224 0.05
225 0.07
226 0.08
227 0.09
228 0.09
229 0.08
230 0.08
231 0.09
232 0.08
233 0.06
234 0.06
235 0.05
236 0.08
237 0.09
238 0.1
239 0.12
240 0.13
241 0.14
242 0.14
243 0.17
244 0.15
245 0.16
246 0.15
247 0.15
248 0.14
249 0.14
250 0.14
251 0.12
252 0.11
253 0.09
254 0.1
255 0.09
256 0.11
257 0.1
258 0.1
259 0.11
260 0.15
261 0.16
262 0.15
263 0.16
264 0.18
265 0.25
266 0.25
267 0.29
268 0.3
269 0.3
270 0.34
271 0.33
272 0.3
273 0.32
274 0.33
275 0.35
276 0.42
277 0.47
278 0.52
279 0.63
280 0.73
281 0.75
282 0.84
283 0.86
284 0.87
285 0.91
286 0.93
287 0.93
288 0.89
289 0.87