Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GFF3

Protein Details
Accession C5GFF3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
101-133VKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, mito_nucl 13.333, cyto_mito 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MTNFRSLLSSSPLSPLISLRTLTTPFTRKIRCTMSSRSIWSLSGSSGRPSTIASQMPWSRISLFAKLGAAVSSNAVKSVAKNVGNANGVGQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.18
4 0.18
5 0.18
6 0.17
7 0.18
8 0.19
9 0.21
10 0.26
11 0.27
12 0.29
13 0.37
14 0.4
15 0.39
16 0.44
17 0.48
18 0.48
19 0.49
20 0.52
21 0.51
22 0.51
23 0.52
24 0.49
25 0.43
26 0.38
27 0.34
28 0.27
29 0.21
30 0.2
31 0.17
32 0.15
33 0.15
34 0.14
35 0.13
36 0.13
37 0.15
38 0.15
39 0.16
40 0.14
41 0.2
42 0.21
43 0.23
44 0.22
45 0.21
46 0.17
47 0.19
48 0.2
49 0.16
50 0.15
51 0.14
52 0.13
53 0.13
54 0.12
55 0.09
56 0.08
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.07
64 0.06
65 0.11
66 0.15
67 0.15
68 0.16
69 0.17
70 0.21
71 0.22
72 0.21
73 0.17
74 0.17
75 0.16
76 0.15
77 0.14
78 0.12
79 0.12
80 0.15
81 0.16
82 0.12
83 0.15
84 0.25
85 0.31
86 0.37
87 0.41
88 0.42
89 0.49
90 0.53
91 0.53
92 0.52
93 0.54
94 0.56
95 0.61
96 0.66
97 0.67
98 0.74
99 0.79
100 0.78
101 0.8
102 0.81
103 0.8
104 0.78
105 0.79
106 0.77
107 0.78
108 0.8
109 0.76
110 0.76
111 0.78
112 0.81
113 0.82