Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094CXC8

Protein Details
Accession A0A094CXC8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-59AVREKEVKRREREKEEKVREEEBasic
NLS Segment(s)
PositionSequence
26-65PKKTEEERAYERAVREKEVKRREREKEEKVREEEEKERAR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 7
Family & Domain DBs
Amino Acid Sequences GADKRQEKTDAVARRMIAGALGIRAPKKTEEERAYERAVREKEVKRREREKEEKVREEEEKERARRSVWED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.3
4 0.22
5 0.14
6 0.12
7 0.09
8 0.09
9 0.09
10 0.09
11 0.1
12 0.11
13 0.12
14 0.17
15 0.19
16 0.27
17 0.29
18 0.34
19 0.38
20 0.4
21 0.41
22 0.38
23 0.36
24 0.34
25 0.31
26 0.28
27 0.31
28 0.34
29 0.42
30 0.5
31 0.57
32 0.59
33 0.67
34 0.73
35 0.75
36 0.78
37 0.79
38 0.8
39 0.82
40 0.81
41 0.77
42 0.73
43 0.67
44 0.63
45 0.58
46 0.56
47 0.56
48 0.52
49 0.52
50 0.49
51 0.47