Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094EBJ8

Protein Details
Accession A0A094EBJ8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-64LQAANEQKKRRERKCKRSEVKALQAANEQKKRRERKRKRRIMQGGSLSIHydrophilic
NLS Segment(s)
PositionSequence
23-55KKRRERKCKRSEVKALQAANEQKKRRERKRKRR
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MMMYSAVLLKAEVKALQAANEQKKRRERKCKRSEVKALQAANEQKKRRERKRKRRIMQGGSLSIQDAEDIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.17
5 0.24
6 0.32
7 0.4
8 0.43
9 0.47
10 0.57
11 0.65
12 0.71
13 0.74
14 0.76
15 0.8
16 0.87
17 0.91
18 0.89
19 0.88
20 0.88
21 0.85
22 0.82
23 0.77
24 0.66
25 0.56
26 0.53
27 0.51
28 0.5
29 0.5
30 0.46
31 0.47
32 0.56
33 0.66
34 0.72
35 0.76
36 0.78
37 0.82
38 0.9
39 0.93
40 0.93
41 0.94
42 0.94
43 0.9
44 0.88
45 0.85
46 0.78
47 0.69
48 0.6
49 0.49
50 0.38
51 0.3