Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CNJ0

Protein Details
Accession Q6CNJ0    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
102-121RYSKGYRKGIHKVPKWTKLSHydrophilic
NLS Segment(s)
PositionSequence
113-116KVPK
Subcellular Location(s) mito 20, cyto_mito 12.166, mito_nucl 12.166, cyto_nucl 3.666, nucl 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG kla:KLLA0_E12211g  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRATQPALGGLLWKVPWRMSGPQKARQRDRLRSVDDVLSTLKLGLHLERNHMAVSEGSQLNLRKIKPRVKSLRILDKAQYFPKEPEMSATDKYSVFNRYSKGYRKGIHKVPKWTKLSIRRNPRHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.13
5 0.13
6 0.13
7 0.16
8 0.19
9 0.26
10 0.32
11 0.42
12 0.47
13 0.55
14 0.63
15 0.69
16 0.73
17 0.75
18 0.76
19 0.75
20 0.77
21 0.76
22 0.72
23 0.66
24 0.62
25 0.54
26 0.45
27 0.37
28 0.29
29 0.21
30 0.17
31 0.13
32 0.1
33 0.08
34 0.08
35 0.08
36 0.14
37 0.14
38 0.17
39 0.18
40 0.19
41 0.18
42 0.18
43 0.17
44 0.1
45 0.11
46 0.12
47 0.11
48 0.1
49 0.13
50 0.13
51 0.15
52 0.18
53 0.18
54 0.2
55 0.26
56 0.33
57 0.36
58 0.46
59 0.53
60 0.55
61 0.62
62 0.62
63 0.67
64 0.64
65 0.6
66 0.54
67 0.5
68 0.49
69 0.45
70 0.41
71 0.32
72 0.3
73 0.34
74 0.32
75 0.27
76 0.27
77 0.26
78 0.26
79 0.26
80 0.26
81 0.22
82 0.21
83 0.22
84 0.21
85 0.21
86 0.2
87 0.21
88 0.22
89 0.26
90 0.32
91 0.4
92 0.45
93 0.49
94 0.52
95 0.57
96 0.64
97 0.68
98 0.71
99 0.7
100 0.74
101 0.76
102 0.8
103 0.76
104 0.74
105 0.74
106 0.74
107 0.78
108 0.77
109 0.79