Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094FYQ1

Protein Details
Accession A0A094FYQ1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
105-126RTGNTIRYNAKRRHWRKTRIGIHydrophilic
NLS Segment(s)
PositionSequence
114-123AKRRHWRKTR
Subcellular Location(s) nucl 10.5, mito 8, cyto_nucl 7, cysk 5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MGAMRAITTTAMEVVEVDGDGEDDETTIERSSSRLRQKHALQHLILRHPAHRITSHPATREMGTEQRTKNTADIPPQSHKSFRTKVKLAKAQKSNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.04
11 0.05
12 0.05
13 0.06
14 0.06
15 0.06
16 0.06
17 0.08
18 0.14
19 0.22
20 0.31
21 0.35
22 0.39
23 0.47
24 0.53
25 0.6
26 0.63
27 0.61
28 0.53
29 0.53
30 0.53
31 0.48
32 0.45
33 0.37
34 0.3
35 0.27
36 0.27
37 0.24
38 0.21
39 0.2
40 0.24
41 0.3
42 0.31
43 0.3
44 0.31
45 0.3
46 0.3
47 0.28
48 0.23
49 0.2
50 0.2
51 0.24
52 0.23
53 0.23
54 0.24
55 0.24
56 0.23
57 0.22
58 0.22
59 0.22
60 0.26
61 0.28
62 0.32
63 0.36
64 0.36
65 0.35
66 0.36
67 0.39
68 0.41
69 0.44
70 0.48
71 0.5
72 0.55
73 0.62
74 0.68
75 0.68
76 0.7
77 0.72
78 0.73
79 0.74
80 0.76
81 0.74
82 0.72
83 0.69
84 0.68
85 0.64
86 0.65
87 0.66
88 0.62
89 0.61
90 0.57
91 0.56
92 0.56
93 0.57
94 0.56
95 0.52
96 0.54
97 0.55
98 0.6
99 0.66
100 0.66
101 0.68
102 0.71
103 0.74
104 0.79
105 0.82
106 0.84