Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094E306

Protein Details
Accession A0A094E306    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
433-453RWNFKVPRVPWKRNTEEQPLLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031563  MOT1/MOT2  
Gene Ontology GO:0016020  C:membrane  
GO:0015098  F:molybdate ion transmembrane transporter activity  
Pfam View protein in Pfam  
PF16983  MFS_MOT1  
Amino Acid Sequences MGRVDFRRFNANNWATLRRYPLAEISGALGDLGTLLPLMIALAVQNSISLSSTLVFSGLWNILTGAIFGIPLPVQPMKAIAAVAISRSFTISETVSAGFFVSGVVLIFSVTGLLHWFTSVIPTPVVKGIQVGAGMSLILSAGTSLLQPLGWTSPSWADNRFWGIGAFLTLLWTHNFPRFPYALVIFVIGIVLSFLLTGPLNLPSLAIWHPHILVPSWISFKTGAIDAGLGQLPLTTLNSVIAVSFLSADLLPHLPAPSVTSLGLSVGLMNLIGGWFGAMPVCHGSGGLAAQYRFGARSGASIIVLGLFKVVMGLVFGETLVGLLRQYPKSLLGVMVLAAGIELAKVGETLNNGARDLWEESEAVGPSIMQGGPVARAFRTPTDEERTQRWTVMVMTIGGLLAFKNDAVGFLAGMLCHWAYNPPSIFSRRAGSRWNFKVPRVPWKRNTEEQPLLSSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.46
3 0.48
4 0.5
5 0.42
6 0.41
7 0.36
8 0.36
9 0.33
10 0.3
11 0.27
12 0.23
13 0.2
14 0.18
15 0.15
16 0.11
17 0.07
18 0.07
19 0.06
20 0.04
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.06
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.1
45 0.1
46 0.1
47 0.09
48 0.1
49 0.1
50 0.1
51 0.1
52 0.07
53 0.06
54 0.06
55 0.05
56 0.07
57 0.06
58 0.06
59 0.1
60 0.1
61 0.1
62 0.11
63 0.12
64 0.12
65 0.13
66 0.13
67 0.09
68 0.1
69 0.1
70 0.11
71 0.11
72 0.1
73 0.09
74 0.1
75 0.1
76 0.09
77 0.11
78 0.1
79 0.1
80 0.11
81 0.12
82 0.11
83 0.11
84 0.1
85 0.08
86 0.07
87 0.06
88 0.04
89 0.04
90 0.04
91 0.04
92 0.03
93 0.04
94 0.04
95 0.03
96 0.04
97 0.03
98 0.03
99 0.04
100 0.05
101 0.05
102 0.05
103 0.06
104 0.05
105 0.09
106 0.1
107 0.1
108 0.1
109 0.11
110 0.12
111 0.14
112 0.14
113 0.11
114 0.1
115 0.1
116 0.1
117 0.1
118 0.09
119 0.07
120 0.06
121 0.06
122 0.05
123 0.04
124 0.03
125 0.03
126 0.02
127 0.02
128 0.02
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.05
136 0.06
137 0.06
138 0.07
139 0.08
140 0.12
141 0.14
142 0.16
143 0.17
144 0.17
145 0.18
146 0.21
147 0.2
148 0.16
149 0.14
150 0.13
151 0.11
152 0.1
153 0.09
154 0.06
155 0.06
156 0.06
157 0.07
158 0.07
159 0.08
160 0.09
161 0.13
162 0.14
163 0.14
164 0.18
165 0.18
166 0.18
167 0.19
168 0.18
169 0.16
170 0.15
171 0.15
172 0.1
173 0.1
174 0.08
175 0.06
176 0.04
177 0.03
178 0.02
179 0.02
180 0.02
181 0.02
182 0.03
183 0.03
184 0.03
185 0.04
186 0.05
187 0.06
188 0.06
189 0.06
190 0.05
191 0.07
192 0.08
193 0.08
194 0.08
195 0.08
196 0.09
197 0.1
198 0.1
199 0.09
200 0.09
201 0.09
202 0.09
203 0.11
204 0.1
205 0.11
206 0.1
207 0.1
208 0.11
209 0.1
210 0.08
211 0.07
212 0.07
213 0.06
214 0.07
215 0.07
216 0.05
217 0.05
218 0.04
219 0.04
220 0.04
221 0.05
222 0.03
223 0.03
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.03
233 0.04
234 0.04
235 0.04
236 0.05
237 0.05
238 0.05
239 0.06
240 0.06
241 0.05
242 0.06
243 0.07
244 0.07
245 0.07
246 0.07
247 0.07
248 0.07
249 0.07
250 0.07
251 0.05
252 0.05
253 0.04
254 0.03
255 0.03
256 0.03
257 0.03
258 0.02
259 0.02
260 0.02
261 0.02
262 0.02
263 0.02
264 0.03
265 0.03
266 0.04
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.05
273 0.06
274 0.06
275 0.07
276 0.07
277 0.08
278 0.08
279 0.08
280 0.08
281 0.09
282 0.08
283 0.06
284 0.08
285 0.09
286 0.09
287 0.09
288 0.09
289 0.08
290 0.08
291 0.08
292 0.07
293 0.05
294 0.04
295 0.04
296 0.04
297 0.04
298 0.02
299 0.03
300 0.03
301 0.03
302 0.03
303 0.03
304 0.03
305 0.03
306 0.03
307 0.03
308 0.03
309 0.03
310 0.06
311 0.11
312 0.11
313 0.13
314 0.14
315 0.15
316 0.16
317 0.17
318 0.15
319 0.11
320 0.1
321 0.09
322 0.09
323 0.07
324 0.06
325 0.05
326 0.04
327 0.03
328 0.02
329 0.02
330 0.02
331 0.02
332 0.03
333 0.03
334 0.05
335 0.06
336 0.09
337 0.13
338 0.14
339 0.15
340 0.15
341 0.15
342 0.17
343 0.18
344 0.16
345 0.13
346 0.12
347 0.13
348 0.16
349 0.16
350 0.13
351 0.11
352 0.09
353 0.08
354 0.1
355 0.09
356 0.06
357 0.06
358 0.07
359 0.09
360 0.11
361 0.12
362 0.1
363 0.13
364 0.15
365 0.18
366 0.23
367 0.25
368 0.29
369 0.36
370 0.42
371 0.43
372 0.46
373 0.49
374 0.44
375 0.42
376 0.36
377 0.3
378 0.25
379 0.24
380 0.2
381 0.14
382 0.13
383 0.12
384 0.11
385 0.1
386 0.08
387 0.06
388 0.05
389 0.05
390 0.05
391 0.06
392 0.06
393 0.07
394 0.09
395 0.09
396 0.08
397 0.09
398 0.09
399 0.08
400 0.08
401 0.09
402 0.07
403 0.07
404 0.07
405 0.11
406 0.12
407 0.2
408 0.21
409 0.22
410 0.28
411 0.32
412 0.35
413 0.34
414 0.4
415 0.38
416 0.4
417 0.46
418 0.49
419 0.55
420 0.59
421 0.67
422 0.64
423 0.63
424 0.69
425 0.65
426 0.68
427 0.68
428 0.71
429 0.7
430 0.76
431 0.8
432 0.8
433 0.82
434 0.81
435 0.79
436 0.72