Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094CYY1

Protein Details
Accession A0A094CYY1   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-74ITDPAERRKRQNRINQRLYRRRHQGKSHRGKASEBasic
NLS Segment(s)
PositionSequence
47-71RRKRQNRINQRLYRRRHQGKSHRGK
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MATESAPAWGAGEEPMAPMIPLVQMRQQAMISVSEEDWVGITDPAERRKRQNRINQRLYRRRHQGKSHRGKASETKSNGVENQVPKDKQDDDDYPKADSPDIQLVTKLSPGNSDSDISDLEIVKQHDPPDFEWPSSVCNFTSSDAQTLIRRFEIWAAKVNHAAHPSPSHLPMLIKFNVWRAFVSNTFTLGLTVEQTGSDDALSPFTTTSPPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.07
6 0.07
7 0.08
8 0.09
9 0.11
10 0.14
11 0.18
12 0.19
13 0.21
14 0.2
15 0.19
16 0.19
17 0.19
18 0.16
19 0.15
20 0.14
21 0.12
22 0.12
23 0.11
24 0.1
25 0.09
26 0.08
27 0.07
28 0.07
29 0.11
30 0.15
31 0.24
32 0.3
33 0.33
34 0.41
35 0.51
36 0.6
37 0.65
38 0.72
39 0.75
40 0.79
41 0.87
42 0.87
43 0.88
44 0.88
45 0.86
46 0.84
47 0.84
48 0.82
49 0.8
50 0.81
51 0.81
52 0.83
53 0.87
54 0.87
55 0.82
56 0.74
57 0.7
58 0.68
59 0.64
60 0.61
61 0.52
62 0.46
63 0.41
64 0.41
65 0.38
66 0.32
67 0.3
68 0.24
69 0.27
70 0.3
71 0.29
72 0.27
73 0.3
74 0.28
75 0.25
76 0.28
77 0.28
78 0.29
79 0.33
80 0.34
81 0.32
82 0.31
83 0.29
84 0.24
85 0.2
86 0.15
87 0.15
88 0.15
89 0.14
90 0.13
91 0.14
92 0.14
93 0.16
94 0.14
95 0.08
96 0.09
97 0.09
98 0.11
99 0.11
100 0.12
101 0.1
102 0.1
103 0.1
104 0.09
105 0.1
106 0.08
107 0.07
108 0.1
109 0.11
110 0.11
111 0.13
112 0.14
113 0.15
114 0.17
115 0.18
116 0.23
117 0.23
118 0.22
119 0.21
120 0.2
121 0.21
122 0.2
123 0.2
124 0.12
125 0.12
126 0.13
127 0.13
128 0.17
129 0.15
130 0.16
131 0.16
132 0.17
133 0.19
134 0.2
135 0.2
136 0.16
137 0.16
138 0.15
139 0.19
140 0.23
141 0.21
142 0.27
143 0.29
144 0.3
145 0.34
146 0.35
147 0.33
148 0.31
149 0.3
150 0.25
151 0.24
152 0.27
153 0.25
154 0.25
155 0.23
156 0.21
157 0.22
158 0.22
159 0.26
160 0.23
161 0.22
162 0.21
163 0.27
164 0.3
165 0.29
166 0.27
167 0.25
168 0.28
169 0.28
170 0.32
171 0.26
172 0.23
173 0.23
174 0.22
175 0.19
176 0.16
177 0.14
178 0.11
179 0.11
180 0.09
181 0.08
182 0.09
183 0.1
184 0.09
185 0.08
186 0.09
187 0.09
188 0.11
189 0.12
190 0.11
191 0.11
192 0.12