Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094D823

Protein Details
Accession A0A094D823   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
198-225ADEGDRKMKKTKPNKKQRIVVRIRERALBasic
248-281VEDAEKRTARNRERKIKRREREKRKKAAAASGMPBasic
NLS Segment(s)
PositionSequence
191-275AKKIGVRADEGDRKMKKTKPNKKQRIVVRIRERALSEKLEAERLRRAREEEEKATRGVEDAEKRTARNRERKIKRREREKRKKAA
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFDLPNAKRVRRDDLYNSDDGNEDAASPIDDSRARHLQDQLAQLYGPITIPSPDAVAPGATEASVDAPPAEAEDEAFEFRLFAPTTIEATSITDPSSTTKVAPTQRIILSNSDDEDQGDGAFTIPHRRLSWYIAAPATGTRKAEFEEAAVSSDTVRRERQQRAWALEKPWRVTIIRTGSTSISQSATAVKAKKIGVRADEGDRKMKKTKPNKKQRIVVRIRERALSEKLEAERLRRAREEEEKATRGVEDAEKRTARNRERKIKRREREKRKKAAAASGMPEPSEQAESVSGGDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.58
4 0.55
5 0.47
6 0.42
7 0.34
8 0.27
9 0.18
10 0.12
11 0.1
12 0.09
13 0.09
14 0.09
15 0.09
16 0.11
17 0.13
18 0.14
19 0.21
20 0.27
21 0.28
22 0.32
23 0.35
24 0.38
25 0.41
26 0.45
27 0.4
28 0.34
29 0.32
30 0.28
31 0.24
32 0.19
33 0.13
34 0.08
35 0.07
36 0.07
37 0.08
38 0.08
39 0.09
40 0.09
41 0.09
42 0.09
43 0.08
44 0.08
45 0.08
46 0.08
47 0.06
48 0.06
49 0.05
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.05
59 0.05
60 0.07
61 0.08
62 0.08
63 0.09
64 0.08
65 0.08
66 0.08
67 0.12
68 0.11
69 0.1
70 0.12
71 0.13
72 0.15
73 0.14
74 0.15
75 0.11
76 0.13
77 0.14
78 0.12
79 0.11
80 0.09
81 0.09
82 0.11
83 0.13
84 0.11
85 0.11
86 0.12
87 0.18
88 0.22
89 0.26
90 0.25
91 0.28
92 0.29
93 0.31
94 0.31
95 0.27
96 0.26
97 0.23
98 0.22
99 0.18
100 0.16
101 0.14
102 0.12
103 0.1
104 0.07
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.09
111 0.1
112 0.13
113 0.14
114 0.16
115 0.17
116 0.2
117 0.25
118 0.22
119 0.23
120 0.21
121 0.2
122 0.18
123 0.18
124 0.18
125 0.14
126 0.13
127 0.11
128 0.12
129 0.13
130 0.13
131 0.12
132 0.09
133 0.09
134 0.09
135 0.09
136 0.09
137 0.08
138 0.07
139 0.09
140 0.1
141 0.11
142 0.12
143 0.15
144 0.22
145 0.27
146 0.33
147 0.38
148 0.42
149 0.46
150 0.5
151 0.49
152 0.47
153 0.47
154 0.44
155 0.38
156 0.34
157 0.31
158 0.26
159 0.23
160 0.27
161 0.27
162 0.26
163 0.24
164 0.25
165 0.24
166 0.24
167 0.24
168 0.18
169 0.13
170 0.11
171 0.1
172 0.1
173 0.11
174 0.14
175 0.15
176 0.14
177 0.18
178 0.19
179 0.22
180 0.25
181 0.26
182 0.25
183 0.27
184 0.29
185 0.32
186 0.37
187 0.36
188 0.4
189 0.39
190 0.4
191 0.43
192 0.46
193 0.49
194 0.54
195 0.63
196 0.65
197 0.75
198 0.82
199 0.85
200 0.87
201 0.87
202 0.87
203 0.85
204 0.85
205 0.84
206 0.8
207 0.73
208 0.68
209 0.61
210 0.54
211 0.49
212 0.42
213 0.33
214 0.3
215 0.29
216 0.33
217 0.32
218 0.3
219 0.35
220 0.36
221 0.39
222 0.37
223 0.39
224 0.39
225 0.47
226 0.52
227 0.51
228 0.55
229 0.52
230 0.5
231 0.47
232 0.4
233 0.32
234 0.27
235 0.26
236 0.25
237 0.26
238 0.34
239 0.35
240 0.36
241 0.43
242 0.5
243 0.53
244 0.57
245 0.64
246 0.67
247 0.77
248 0.86
249 0.9
250 0.91
251 0.92
252 0.92
253 0.93
254 0.94
255 0.94
256 0.95
257 0.95
258 0.94
259 0.92
260 0.86
261 0.84
262 0.81
263 0.76
264 0.68
265 0.63
266 0.54
267 0.46
268 0.4
269 0.31
270 0.25
271 0.21
272 0.17
273 0.13
274 0.13
275 0.14
276 0.14