Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094CRH5

Protein Details
Accession A0A094CRH5   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
27-56HYTRPVGIQKKTRKEKEKERKEKEDKMREVBasic
NLS Segment(s)
PositionSequence
34-80IQKKTRKEKEKERKEKEDKMREVIRAEVLKEIEDQKEKKKKAIPKAP
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MPGNSLPFRPRAPLPPHYTPRAPLPPHYTRPVGIQKKTRKEKEKERKEKEDKMREVIRAEVLKEIEDQKEKKKKAIPKAPLTHAQRLRKEELLCQKAVFPDMFRAAKAKIEKKKEAIATIMEALEEAREEEREAQREKKELDSQLSEIIVELKKLSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.64
4 0.66
5 0.65
6 0.58
7 0.59
8 0.59
9 0.54
10 0.5
11 0.52
12 0.54
13 0.57
14 0.59
15 0.52
16 0.44
17 0.49
18 0.53
19 0.53
20 0.51
21 0.55
22 0.6
23 0.68
24 0.78
25 0.8
26 0.79
27 0.8
28 0.85
29 0.87
30 0.89
31 0.89
32 0.88
33 0.89
34 0.88
35 0.89
36 0.88
37 0.87
38 0.79
39 0.75
40 0.71
41 0.62
42 0.55
43 0.46
44 0.4
45 0.31
46 0.27
47 0.23
48 0.18
49 0.16
50 0.17
51 0.17
52 0.15
53 0.19
54 0.2
55 0.27
56 0.35
57 0.36
58 0.39
59 0.44
60 0.49
61 0.54
62 0.62
63 0.61
64 0.62
65 0.67
66 0.66
67 0.67
68 0.65
69 0.62
70 0.6
71 0.59
72 0.54
73 0.53
74 0.53
75 0.49
76 0.45
77 0.43
78 0.45
79 0.42
80 0.37
81 0.33
82 0.31
83 0.27
84 0.28
85 0.22
86 0.13
87 0.13
88 0.17
89 0.17
90 0.16
91 0.18
92 0.17
93 0.21
94 0.27
95 0.32
96 0.36
97 0.43
98 0.48
99 0.49
100 0.55
101 0.53
102 0.48
103 0.42
104 0.36
105 0.3
106 0.27
107 0.23
108 0.16
109 0.13
110 0.11
111 0.09
112 0.07
113 0.06
114 0.06
115 0.06
116 0.08
117 0.14
118 0.19
119 0.25
120 0.29
121 0.34
122 0.38
123 0.43
124 0.44
125 0.45
126 0.48
127 0.47
128 0.5
129 0.48
130 0.45
131 0.42
132 0.4
133 0.32
134 0.25
135 0.25
136 0.19
137 0.15