Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094C1S3

Protein Details
Accession A0A094C1S3   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
3-37PHQARRPPPRASPQHQHRQKQTHHPRPHNNPLTLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto_nucl 7.5, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR024738  Hfi1/Tada1  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
Pfam View protein in Pfam  
PF12767  SAGA-Tad1  
Amino Acid Sequences MVPHQARRPPPRASPQHQHRQKQTHHPRPHNNPLTLPNTLAGYPQLRPVQCADNRTNPPDPGHAPPSRAGRASQALYHPAMPDIDPAALSRPSLTSSTPILPPKSLSIVPPSAPKISKSNHVPPRIDLEPLYTALKAAVGENWATYKEAVSLFVMGQYNQAELSAKIDWFLTVPGTDTEHLHNQLVAAIYGNVTREMPDLGVAAWVSANDKPTPGAGAKPVTGDAAEQRLKAEVMSLPNRDRRRLKDLKLDWDGPDPYTTLLSTSRNPLPTPSAPTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.84
4 0.87
5 0.87
6 0.86
7 0.86
8 0.85
9 0.85
10 0.86
11 0.86
12 0.87
13 0.88
14 0.89
15 0.89
16 0.92
17 0.9
18 0.81
19 0.75
20 0.71
21 0.66
22 0.57
23 0.48
24 0.37
25 0.3
26 0.27
27 0.23
28 0.19
29 0.16
30 0.16
31 0.21
32 0.26
33 0.24
34 0.26
35 0.28
36 0.34
37 0.35
38 0.4
39 0.39
40 0.43
41 0.48
42 0.52
43 0.53
44 0.46
45 0.45
46 0.43
47 0.42
48 0.38
49 0.4
50 0.37
51 0.35
52 0.38
53 0.42
54 0.39
55 0.37
56 0.32
57 0.3
58 0.32
59 0.31
60 0.29
61 0.25
62 0.26
63 0.26
64 0.26
65 0.21
66 0.17
67 0.16
68 0.14
69 0.12
70 0.1
71 0.09
72 0.08
73 0.08
74 0.1
75 0.1
76 0.1
77 0.09
78 0.09
79 0.1
80 0.11
81 0.12
82 0.11
83 0.13
84 0.16
85 0.19
86 0.22
87 0.21
88 0.21
89 0.21
90 0.2
91 0.21
92 0.2
93 0.17
94 0.18
95 0.18
96 0.19
97 0.21
98 0.22
99 0.22
100 0.22
101 0.23
102 0.23
103 0.23
104 0.29
105 0.32
106 0.4
107 0.45
108 0.5
109 0.49
110 0.45
111 0.49
112 0.43
113 0.37
114 0.27
115 0.22
116 0.18
117 0.18
118 0.18
119 0.11
120 0.1
121 0.09
122 0.1
123 0.07
124 0.06
125 0.05
126 0.05
127 0.05
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.07
135 0.07
136 0.08
137 0.07
138 0.08
139 0.07
140 0.1
141 0.1
142 0.08
143 0.09
144 0.09
145 0.09
146 0.08
147 0.08
148 0.06
149 0.06
150 0.08
151 0.08
152 0.08
153 0.08
154 0.08
155 0.08
156 0.07
157 0.08
158 0.06
159 0.05
160 0.06
161 0.07
162 0.09
163 0.09
164 0.1
165 0.13
166 0.15
167 0.17
168 0.16
169 0.15
170 0.14
171 0.14
172 0.14
173 0.11
174 0.08
175 0.06
176 0.07
177 0.07
178 0.08
179 0.07
180 0.06
181 0.07
182 0.07
183 0.08
184 0.07
185 0.07
186 0.07
187 0.06
188 0.07
189 0.06
190 0.06
191 0.05
192 0.05
193 0.07
194 0.08
195 0.1
196 0.09
197 0.1
198 0.1
199 0.11
200 0.13
201 0.13
202 0.13
203 0.15
204 0.17
205 0.17
206 0.18
207 0.18
208 0.16
209 0.15
210 0.14
211 0.12
212 0.17
213 0.18
214 0.18
215 0.18
216 0.19
217 0.19
218 0.17
219 0.17
220 0.13
221 0.19
222 0.24
223 0.28
224 0.32
225 0.41
226 0.45
227 0.51
228 0.55
229 0.55
230 0.6
231 0.65
232 0.67
233 0.69
234 0.72
235 0.74
236 0.74
237 0.7
238 0.62
239 0.59
240 0.54
241 0.44
242 0.38
243 0.29
244 0.23
245 0.21
246 0.18
247 0.14
248 0.16
249 0.18
250 0.2
251 0.25
252 0.3
253 0.32
254 0.32
255 0.34
256 0.38
257 0.39