Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U304

Protein Details
Accession A0A179U304    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MKREREKKSITVNKQQQKKIEKKLIEKKIKIHydrophilic
NLS Segment(s)
PositionSequence
18-27KKIEKKLIEK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MKREREKKSITVNKQQQKKIEKKLIEKKIKILFRSQMHFIIQNIKKTALLSEYVNLLTAEIEPETADQKIQDFKMQIDLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.76
4 0.76
5 0.77
6 0.76
7 0.75
8 0.73
9 0.74
10 0.79
11 0.82
12 0.81
13 0.74
14 0.71
15 0.7
16 0.68
17 0.59
18 0.54
19 0.5
20 0.45
21 0.46
22 0.41
23 0.35
24 0.31
25 0.31
26 0.26
27 0.29
28 0.27
29 0.27
30 0.26
31 0.24
32 0.24
33 0.23
34 0.23
35 0.15
36 0.14
37 0.11
38 0.11
39 0.12
40 0.11
41 0.12
42 0.11
43 0.09
44 0.08
45 0.07
46 0.07
47 0.06
48 0.06
49 0.05
50 0.06
51 0.08
52 0.08
53 0.08
54 0.08
55 0.11
56 0.16
57 0.17
58 0.21
59 0.21
60 0.22