Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TN56

Protein Details
Accession A7TN56    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
138-161LDVKGRKYAKKLEEKKKYDKVTWFHydrophilic
NLS Segment(s)
PositionSequence
144-150KYAKKLE
152-152K
Subcellular Location(s) mito 20, mito_nucl 12.999, cyto_mito 11.999, cyto_nucl 4.666, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG vpo:Kpol_1053p10  -  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MRASPSVMNSVKYFEFLPSSLKTFFNKYPPSIKYATKPVSTYDVVANPFLPNKHPVTGRYHEPKYSKRRMSDLYKMAHSYGIQEFLPPMNKKFFEEKYDKKTFMRGVLTPKGHKHEFARQSKLAKMEVAIKNADKYILDVKGRKYAKKLEEKKKYDKVTWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.17
4 0.21
5 0.19
6 0.22
7 0.23
8 0.25
9 0.25
10 0.29
11 0.32
12 0.37
13 0.39
14 0.39
15 0.45
16 0.45
17 0.48
18 0.46
19 0.45
20 0.41
21 0.46
22 0.47
23 0.42
24 0.41
25 0.38
26 0.4
27 0.37
28 0.33
29 0.26
30 0.25
31 0.23
32 0.22
33 0.21
34 0.16
35 0.17
36 0.16
37 0.15
38 0.16
39 0.17
40 0.2
41 0.21
42 0.23
43 0.29
44 0.32
45 0.37
46 0.41
47 0.41
48 0.43
49 0.46
50 0.52
51 0.54
52 0.6
53 0.58
54 0.53
55 0.56
56 0.57
57 0.59
58 0.58
59 0.55
60 0.48
61 0.44
62 0.42
63 0.37
64 0.32
65 0.25
66 0.19
67 0.13
68 0.12
69 0.1
70 0.1
71 0.1
72 0.1
73 0.16
74 0.14
75 0.15
76 0.18
77 0.18
78 0.21
79 0.26
80 0.27
81 0.28
82 0.36
83 0.4
84 0.45
85 0.5
86 0.49
87 0.44
88 0.47
89 0.43
90 0.39
91 0.37
92 0.31
93 0.33
94 0.38
95 0.41
96 0.4
97 0.42
98 0.43
99 0.4
100 0.41
101 0.39
102 0.41
103 0.48
104 0.51
105 0.54
106 0.52
107 0.55
108 0.55
109 0.53
110 0.45
111 0.35
112 0.29
113 0.32
114 0.31
115 0.31
116 0.3
117 0.28
118 0.28
119 0.27
120 0.27
121 0.17
122 0.17
123 0.19
124 0.22
125 0.26
126 0.28
127 0.31
128 0.4
129 0.44
130 0.45
131 0.45
132 0.49
133 0.54
134 0.61
135 0.69
136 0.71
137 0.78
138 0.82
139 0.86
140 0.87
141 0.85