Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094FX13

Protein Details
Accession A0A094FX13   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
132-159VVRGKEKQAPPQKKQKVKKVKLSFGDDEHydrophilic
NLS Segment(s)
PositionSequence
94-114RERKEEKIASIGATRKRKVGK
135-151GKEKQAPPQKKQKVKKV
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSPKITSKSLSYDASLPPFLQRLRAENVGASTAAPRAKRAANPDADEEDEPVYVDEEGGALDDAELRSLGVTKKGGEKGEEAAEEAKPEAVGERERKEEKIASIGATRKRKVGKVVGAPEEEEGKGSDTTAVVRGKEKQAPPQKKQKVKKVKLSFGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.26
4 0.23
5 0.26
6 0.24
7 0.26
8 0.25
9 0.26
10 0.3
11 0.33
12 0.31
13 0.28
14 0.29
15 0.24
16 0.22
17 0.18
18 0.13
19 0.13
20 0.16
21 0.15
22 0.15
23 0.17
24 0.2
25 0.24
26 0.3
27 0.34
28 0.36
29 0.38
30 0.41
31 0.39
32 0.38
33 0.35
34 0.29
35 0.23
36 0.17
37 0.15
38 0.11
39 0.09
40 0.07
41 0.06
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.06
57 0.07
58 0.08
59 0.09
60 0.13
61 0.16
62 0.17
63 0.17
64 0.17
65 0.17
66 0.18
67 0.17
68 0.13
69 0.12
70 0.11
71 0.1
72 0.09
73 0.07
74 0.05
75 0.05
76 0.05
77 0.06
78 0.1
79 0.13
80 0.16
81 0.21
82 0.23
83 0.24
84 0.26
85 0.26
86 0.23
87 0.23
88 0.22
89 0.18
90 0.21
91 0.25
92 0.3
93 0.35
94 0.35
95 0.36
96 0.39
97 0.4
98 0.43
99 0.45
100 0.45
101 0.47
102 0.53
103 0.52
104 0.49
105 0.46
106 0.41
107 0.35
108 0.28
109 0.2
110 0.14
111 0.12
112 0.11
113 0.11
114 0.11
115 0.09
116 0.1
117 0.15
118 0.16
119 0.15
120 0.18
121 0.22
122 0.27
123 0.35
124 0.37
125 0.42
126 0.51
127 0.6
128 0.65
129 0.72
130 0.77
131 0.79
132 0.86
133 0.87
134 0.88
135 0.87
136 0.91
137 0.9
138 0.89
139 0.87