Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094DRY4

Protein Details
Accession A0A094DRY4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
19-61TGNKFKRQDLHVKQKKARDSLRRDERFKRKREEDKDPELRRERBasic
NLS Segment(s)
PositionSequence
29-60HVKQKKARDSLRRDERFKRKREEDKDPELRRE
Subcellular Location(s) mito 12, mito_nucl 11.666, nucl 10, cyto_mito 8.666, cyto_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
IPR044281  IMP4/RPF1  
Gene Ontology GO:0042134  F:rRNA primary transcript binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MVAKRQKPLSSKAALPFVTGNKFKRQDLHVKQKKARDSLRRDERFKRKREEDKDPELRRERLARNVPMTIDKKRVWDEEDGDGLNVSVDVEQLRRRRLEAAEAGDAMDEDLPEQAAEDDVDSMLGSDEEMDDEEEDTEHSARRQRDASNAPSLAASTTSTNLDLTPESLALKFPTLFNDEPPPPPKVLLTTSLNSTLHNEAHLLCTLFPNSTYIPRSAHRYGHKFSVREIAKFATNRSYTALVVVKEDAKKPTGLSIVHLPHGPTCHFSIANWVEGKKLPGHGNPTNHYPELILNNFRTPLGLLTARLFLTLFPPQPELQGRQVVTLHNQRDYIFVRRHRYVFRDKRATEKSVVGPDGEKVKGVEEIRAGLQELGPRFTLKLRRVDKGIGRAGSQGDDGLQWEWKAHMEKKRTRFNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.46
4 0.43
5 0.45
6 0.45
7 0.43
8 0.46
9 0.49
10 0.5
11 0.52
12 0.54
13 0.57
14 0.62
15 0.69
16 0.69
17 0.75
18 0.8
19 0.81
20 0.82
21 0.8
22 0.79
23 0.79
24 0.78
25 0.79
26 0.83
27 0.84
28 0.83
29 0.84
30 0.86
31 0.85
32 0.84
33 0.84
34 0.83
35 0.85
36 0.86
37 0.87
38 0.85
39 0.86
40 0.88
41 0.83
42 0.83
43 0.79
44 0.73
45 0.68
46 0.67
47 0.61
48 0.6
49 0.63
50 0.6
51 0.58
52 0.57
53 0.53
54 0.53
55 0.53
56 0.48
57 0.46
58 0.41
59 0.42
60 0.44
61 0.46
62 0.41
63 0.42
64 0.4
65 0.37
66 0.38
67 0.33
68 0.28
69 0.25
70 0.21
71 0.15
72 0.11
73 0.08
74 0.05
75 0.05
76 0.05
77 0.08
78 0.14
79 0.18
80 0.23
81 0.24
82 0.25
83 0.3
84 0.3
85 0.35
86 0.35
87 0.36
88 0.33
89 0.32
90 0.3
91 0.26
92 0.24
93 0.17
94 0.11
95 0.07
96 0.05
97 0.04
98 0.04
99 0.04
100 0.05
101 0.04
102 0.04
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.04
109 0.05
110 0.04
111 0.04
112 0.04
113 0.03
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.08
126 0.09
127 0.15
128 0.16
129 0.2
130 0.23
131 0.24
132 0.31
133 0.37
134 0.39
135 0.4
136 0.39
137 0.36
138 0.32
139 0.31
140 0.23
141 0.17
142 0.13
143 0.07
144 0.08
145 0.08
146 0.09
147 0.09
148 0.08
149 0.09
150 0.08
151 0.08
152 0.07
153 0.07
154 0.08
155 0.08
156 0.08
157 0.08
158 0.09
159 0.08
160 0.08
161 0.1
162 0.14
163 0.14
164 0.15
165 0.21
166 0.21
167 0.25
168 0.27
169 0.26
170 0.22
171 0.22
172 0.21
173 0.18
174 0.18
175 0.18
176 0.2
177 0.19
178 0.2
179 0.22
180 0.22
181 0.2
182 0.2
183 0.18
184 0.14
185 0.13
186 0.13
187 0.1
188 0.11
189 0.12
190 0.09
191 0.08
192 0.08
193 0.09
194 0.08
195 0.08
196 0.08
197 0.08
198 0.11
199 0.13
200 0.13
201 0.15
202 0.16
203 0.23
204 0.24
205 0.29
206 0.32
207 0.36
208 0.37
209 0.44
210 0.47
211 0.41
212 0.39
213 0.42
214 0.37
215 0.32
216 0.32
217 0.25
218 0.24
219 0.25
220 0.25
221 0.23
222 0.22
223 0.22
224 0.22
225 0.22
226 0.18
227 0.2
228 0.22
229 0.15
230 0.15
231 0.15
232 0.17
233 0.17
234 0.19
235 0.18
236 0.16
237 0.17
238 0.16
239 0.18
240 0.18
241 0.16
242 0.16
243 0.22
244 0.22
245 0.23
246 0.23
247 0.21
248 0.18
249 0.2
250 0.19
251 0.14
252 0.14
253 0.15
254 0.14
255 0.14
256 0.22
257 0.21
258 0.24
259 0.24
260 0.22
261 0.21
262 0.22
263 0.24
264 0.17
265 0.2
266 0.19
267 0.21
268 0.29
269 0.33
270 0.37
271 0.38
272 0.42
273 0.42
274 0.38
275 0.35
276 0.29
277 0.26
278 0.26
279 0.27
280 0.25
281 0.21
282 0.23
283 0.23
284 0.22
285 0.2
286 0.15
287 0.13
288 0.13
289 0.13
290 0.12
291 0.13
292 0.15
293 0.15
294 0.15
295 0.14
296 0.1
297 0.13
298 0.16
299 0.16
300 0.16
301 0.19
302 0.19
303 0.23
304 0.27
305 0.27
306 0.27
307 0.31
308 0.3
309 0.29
310 0.31
311 0.28
312 0.31
313 0.35
314 0.34
315 0.3
316 0.31
317 0.29
318 0.33
319 0.34
320 0.36
321 0.35
322 0.4
323 0.45
324 0.49
325 0.53
326 0.54
327 0.58
328 0.61
329 0.64
330 0.67
331 0.7
332 0.66
333 0.72
334 0.73
335 0.7
336 0.63
337 0.58
338 0.53
339 0.49
340 0.49
341 0.4
342 0.34
343 0.32
344 0.34
345 0.28
346 0.23
347 0.17
348 0.17
349 0.22
350 0.22
351 0.22
352 0.18
353 0.2
354 0.2
355 0.21
356 0.2
357 0.15
358 0.16
359 0.18
360 0.18
361 0.18
362 0.18
363 0.18
364 0.18
365 0.24
366 0.31
367 0.32
368 0.41
369 0.44
370 0.49
371 0.52
372 0.59
373 0.6
374 0.6
375 0.62
376 0.54
377 0.5
378 0.47
379 0.44
380 0.38
381 0.31
382 0.22
383 0.16
384 0.14
385 0.15
386 0.13
387 0.14
388 0.12
389 0.13
390 0.13
391 0.18
392 0.24
393 0.3
394 0.38
395 0.46
396 0.55
397 0.64