FuNGI

A0A094F109

Protein Details

Accession

A0A094F109

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
459-485	YEKLRAEKDKERWARLRKVKSLFEGKG	Basic

NLS Segment(s)

Position	Sequence
464-493	AEKDKERWARLRKVKSLFEGKGKKATKSKQ

Subcellular Location(s)

nucl 11.5, cyto_nucl 11.5, cyto 10.5, pero 5

Family & Domain DBs

InterPro	View protein in InterPro IPR013909 NIPA/Rsm1_C IPR012935 Znf_C3HC-like
Gene Ontology	GO:0005634 C:nucleus GO:0008270 F:zinc ion binding
Pfam	View protein in Pfam PF08600 Rsm1 PF07967 zf-C3HC

Amino Acid Sequences

MTFDPGKSWSLQEELQQLISQIEEFPFWVDESDSIWLEETASFWLDDSNSSASSDNSSTDMNNTKRKFNALLNSIGSSSSDDLTRTTKQARTSYDAFHRSSSSSPNLSTSSRTAAVARMSKTDLKFAAANSAKARGMGEPVTKPSFLPGDRDDFLERLATFRNLTDWMPKPPKVNEVAWAKRGWACQRLERVRCVTCNVEIMVKLNKQEDENGKVIKFAGMESDIEQALVDKYADLIITSHDVLCPWRKRGCDDSIFKQPIYPITATFQVLKARYDSLLSMAALLPAESVFLLPPTYDLDAIIAQLPAPFTANASPETPLNRVALILALFGFTARPAHVPKLGSADCRVCFRTVGLWLYRPKTSKGADGSPGVERAAAMASLNPLECHKEYCPWVNAGSQNGGGAAGGKPIWAILGEAIGREDKVRKQDEAGKGDKGAAAVGEETHVETDGDVADDGEYEKLRAEKDKERWARLRKVKSLFEGKGKKATKSKQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.28
2	0.28
3	0.26
4	0.24
5	0.21
6	0.19
7	0.15
8	0.12
9	0.11
10	0.1
11	0.1
12	0.11
13	0.12
14	0.12
15	0.12
16	0.11
17	0.11
18	0.13
19	0.15
20	0.14
21	0.14
22	0.14
23	0.13
24	0.13
25	0.13
26	0.11
27	0.1
28	0.1
29	0.1
30	0.09
31	0.11
32	0.1
33	0.11
34	0.13
35	0.14
36	0.13
37	0.15
38	0.15
39	0.14
40	0.18
41	0.18
42	0.15
43	0.15
44	0.15
45	0.14
46	0.18
47	0.26
48	0.29
49	0.37
50	0.38
51	0.42
52	0.44
53	0.48
54	0.48
55	0.46
56	0.49
57	0.44
58	0.47
59	0.44
60	0.43
61	0.39
62	0.34
63	0.28
64	0.21
65	0.18
66	0.14
67	0.12
68	0.11
69	0.13
70	0.17
71	0.19
72	0.21
73	0.25
74	0.28
75	0.34
76	0.39
77	0.43
78	0.45
79	0.46
80	0.48
81	0.52
82	0.54
83	0.48
84	0.44
85	0.41
86	0.36
87	0.35
88	0.34
89	0.3
90	0.27
91	0.26
92	0.27
93	0.28
94	0.28
95	0.29
96	0.25
97	0.24
98	0.22
99	0.23
100	0.21
101	0.2
102	0.25
103	0.27
104	0.26
105	0.24
106	0.26
107	0.31
108	0.31
109	0.32
110	0.27
111	0.25
112	0.25
113	0.23
114	0.3
115	0.26
116	0.28
117	0.25
118	0.27
119	0.25
120	0.24
121	0.25
122	0.15
123	0.17
124	0.17
125	0.2
126	0.18
127	0.23
128	0.24
129	0.24
130	0.23
131	0.22
132	0.24
133	0.2
134	0.23
135	0.21
136	0.25
137	0.25
138	0.28
139	0.27
140	0.23
141	0.23
142	0.21
143	0.18
144	0.14
145	0.15
146	0.14
147	0.13
148	0.13
149	0.14
150	0.13
151	0.14
152	0.2
153	0.2
154	0.28
155	0.33
156	0.35
157	0.38
158	0.38
159	0.42
160	0.39
161	0.38
162	0.37
163	0.4
164	0.41
165	0.4
166	0.38
167	0.35
168	0.33
169	0.36
170	0.33
171	0.3
172	0.29
173	0.32
174	0.42
175	0.49
176	0.49
177	0.49
178	0.5
179	0.46
180	0.44
181	0.42
182	0.34
183	0.27
184	0.26
185	0.22
186	0.18
187	0.16
188	0.16
189	0.17
190	0.16
191	0.17
192	0.17
193	0.17
194	0.16
195	0.21
196	0.23
197	0.23
198	0.25
199	0.25
200	0.23
201	0.23
202	0.22
203	0.18
204	0.14
205	0.1
206	0.08
207	0.08
208	0.08
209	0.09
210	0.1
211	0.09
212	0.08
213	0.08
214	0.07
215	0.06
216	0.06
217	0.05
218	0.04
219	0.04
220	0.04
221	0.04
222	0.04
223	0.04
224	0.04
225	0.06
226	0.06
227	0.06
228	0.06
229	0.06
230	0.08
231	0.15
232	0.17
233	0.2
234	0.23
235	0.24
236	0.27
237	0.33
238	0.37
239	0.38
240	0.4
241	0.4
242	0.47
243	0.48
244	0.44
245	0.39
246	0.34
247	0.28
248	0.27
249	0.23
250	0.14
251	0.14
252	0.16
253	0.16
254	0.16
255	0.16
256	0.15
257	0.16
258	0.16
259	0.15
260	0.14
261	0.14
262	0.14
263	0.12
264	0.1
265	0.1
266	0.09
267	0.09
268	0.08
269	0.08
270	0.07
271	0.07
272	0.05
273	0.04
274	0.04
275	0.03
276	0.03
277	0.03
278	0.03
279	0.04
280	0.03
281	0.04
282	0.06
283	0.07
284	0.07
285	0.07
286	0.07
287	0.07
288	0.08
289	0.08
290	0.06
291	0.06
292	0.06
293	0.06
294	0.05
295	0.06
296	0.06
297	0.06
298	0.08
299	0.09
300	0.1
301	0.11
302	0.12
303	0.12
304	0.15
305	0.15
306	0.15
307	0.14
308	0.13
309	0.12
310	0.11
311	0.11
312	0.08
313	0.07
314	0.06
315	0.05
316	0.05
317	0.05
318	0.05
319	0.04
320	0.05
321	0.05
322	0.08
323	0.1
324	0.13
325	0.16
326	0.17
327	0.18
328	0.25
329	0.26
330	0.25
331	0.26
332	0.28
333	0.26
334	0.29
335	0.29
336	0.23
337	0.22
338	0.21
339	0.2
340	0.19
341	0.22
342	0.21
343	0.25
344	0.29
345	0.31
346	0.35
347	0.34
348	0.33
349	0.35
350	0.35
351	0.36
352	0.36
353	0.37
354	0.37
355	0.37
356	0.36
357	0.31
358	0.3
359	0.24
360	0.19
361	0.15
362	0.12
363	0.1
364	0.08
365	0.06
366	0.06
367	0.07
368	0.08
369	0.08
370	0.08
371	0.09
372	0.13
373	0.14
374	0.17
375	0.17
376	0.22
377	0.26
378	0.32
379	0.34
380	0.31
381	0.32
382	0.32
383	0.33
384	0.31
385	0.29
386	0.23
387	0.2
388	0.18
389	0.16
390	0.12
391	0.11
392	0.08
393	0.07
394	0.07
395	0.07
396	0.06
397	0.06
398	0.07
399	0.05
400	0.06
401	0.04
402	0.07
403	0.07
404	0.08
405	0.09
406	0.1
407	0.1
408	0.12
409	0.16
410	0.18
411	0.26
412	0.3
413	0.31
414	0.36
415	0.44
416	0.51
417	0.54
418	0.53
419	0.47
420	0.44
421	0.44
422	0.39
423	0.3
424	0.22
425	0.15
426	0.12
427	0.1
428	0.09
429	0.09
430	0.08
431	0.08
432	0.08
433	0.09
434	0.08
435	0.07
436	0.08
437	0.07
438	0.08
439	0.07
440	0.07
441	0.06
442	0.07
443	0.08
444	0.09
445	0.09
446	0.09
447	0.11
448	0.13
449	0.15
450	0.22
451	0.28
452	0.35
453	0.43
454	0.54
455	0.6
456	0.67
457	0.75
458	0.77
459	0.82
460	0.82
461	0.84
462	0.82
463	0.82
464	0.8
465	0.79
466	0.8
467	0.75
468	0.75
469	0.74
470	0.7
471	0.71
472	0.67
473	0.67

A0A094F109

3D AlphaFold-predicted Structure Viewer