Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094F9Y5

Protein Details
Accession A0A094F9Y5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-85SSGEKRQSRARPRRDTRPHRPAABasic
NLS Segment(s)
PositionSequence
68-81RQSRARPRRDTRPH
Subcellular Location(s) mito 14, nucl 12, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MRPQCANKTPMTAQIRKKGREGHGATCNVHGFPLIGSGPLLAPVTQIPHPGTSQSPLSYSTNSSGEKRQSRARPRRDTRPHRPAASLPSLPSSFVLDPWSLLRLSRGYATRAAFPYPHTEVTGLEYSVGLRCDGEKVPLALAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.62
4 0.66
5 0.65
6 0.62
7 0.64
8 0.61
9 0.59
10 0.59
11 0.6
12 0.55
13 0.5
14 0.45
15 0.35
16 0.3
17 0.22
18 0.14
19 0.1
20 0.12
21 0.09
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.06
29 0.06
30 0.06
31 0.09
32 0.09
33 0.12
34 0.12
35 0.13
36 0.13
37 0.14
38 0.15
39 0.14
40 0.16
41 0.14
42 0.14
43 0.15
44 0.17
45 0.16
46 0.16
47 0.16
48 0.18
49 0.18
50 0.19
51 0.2
52 0.25
53 0.28
54 0.3
55 0.35
56 0.41
57 0.5
58 0.58
59 0.64
60 0.69
61 0.71
62 0.79
63 0.82
64 0.84
65 0.84
66 0.84
67 0.8
68 0.71
69 0.68
70 0.6
71 0.55
72 0.51
73 0.41
74 0.31
75 0.29
76 0.27
77 0.25
78 0.23
79 0.2
80 0.14
81 0.13
82 0.15
83 0.11
84 0.12
85 0.12
86 0.13
87 0.1
88 0.1
89 0.11
90 0.1
91 0.11
92 0.15
93 0.16
94 0.17
95 0.22
96 0.23
97 0.26
98 0.27
99 0.27
100 0.24
101 0.23
102 0.28
103 0.27
104 0.27
105 0.23
106 0.22
107 0.21
108 0.25
109 0.26
110 0.19
111 0.16
112 0.14
113 0.14
114 0.16
115 0.16
116 0.11
117 0.09
118 0.1
119 0.13
120 0.14
121 0.16
122 0.18
123 0.18